By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: NYSE Content Advisory: Pre-Market update + NYSE co-creates ‘Taking Stock’ content series
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > News > NYSE Content Advisory: Pre-Market update + NYSE co-creates ‘Taking Stock’ content series
News

NYSE Content Advisory: Pre-Market update + NYSE co-creates ‘Taking Stock’ content series

Last updated: 07/06/2025 1:08 PM
Published: 04/06/2025
Share
SHARE

NEW YORK, June 3, 2025 /PRNewswire/ — The New York Stock Exchange (NYSE) provides a daily pre-market update directly from the NYSE Trading Floor. Access today’s NYSE Pre-market update for market insights before trading begins. 

- Advertisement -

J.D. Durkin delivers the pre-market update on Jun 3rd

- Advertisement -
  • The major averages are moving lower ahead of today’s open after the Organization for Economic Co-Operation and Development cut its economic forecast for the U.S. and globally in lieu of the recent tariff ramp-up.
  • Earlier today, at a leading financial technology conference in Amsterdam, the NYSE, in collaboration with Money 20/20, FINTECH TV, and Cheddar, announced a new content series called Taking Stock
  • The Taking Stock program will air weekdays, live from the NYSE trading floor, talking finance of the future. The first episode debuts in mid-August, distributed across all major platforms, and will be hosted by J.D. Durkin.

Click here to watch a preview of Taking Stock

- Advertisement -

Opening Bell
OLO (NYSE: OLO) celebrates its 20th anniversary

- Advertisement -

Closing Bell
Madrona celebrates the winners of the 2024 Madrona IA40 List

- Advertisement -

Video – https://mma.prnewswire.com/media/2702222/NYSE_Market_Update_June_3.mp4

- Advertisement -

Logo – https://mma.prnewswire.com/media/2581322/New_York_Stock_Exchange_Logo.jpg

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/nyse-content-advisory-pre-market-update–nyse-co-creates-taking-stock-content-series-302471966.html

- Advertisement -
Flare Therapeutics Presents Part A Data from FX-909 Phase 1 Study at AACR-NCI-EORTC International Conference
Sentient Digital, Inc. (SDi) Partners with Viasat to Support Korea Coast Guard Maritime Domain Awareness and Information Sharing Missions
Avacta Therapeutics Presents Compelling Phase 1a Data for Faridoxorubicin and the pre|CISION Platform at the European Society of Medical Oncology Annual Congress
NYSE Content Advisory: Pre-Market update + Wall Street readies for key economic data
BrowserStack Launches Accessibility Design Toolkit to Shift Accessibility Left
TAGGED:‘takingaccessadvisorybeforebeginsclickco-createscontentdailydeliversdirectlydurkinexchangefloorinsightsjunjunemarketnewsnysepre-marketpremarketpreview:providesseriesstocktoday’stradinguncategorizedupdatewatchyork
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
HarperCollins India to publish Navya Naveli Nanda & Samyak Chakrabarty’s new book The Map: A playbook to navigate the new world
News

HarperCollins India to publish Navya Naveli Nanda & Samyak Chakrabarty’s new book The Map: A playbook to navigate the new world

28/11/2025
Xinhua Silk Road: China’s Liangzhu kicks off dialogue between Chinese, Roman civilizations
Enfinity Global Sells Minority Stakes in 380 MW Energy Storage Projects in the US and Italy to Daiwa Energy & Infrastructure
JustCo launches THE COLLECTIVE in India with flagship centres in Gurugram and Bengaluru
Desay Battery Unveils Proactive-Safety-Focused Energy Storage Technologies
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?