By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: Dstillerys Melinda Han Williams Named to ADWEEKs AI Power 50
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > Technology > Dstillerys Melinda Han Williams Named to ADWEEKs AI Power 50
Dstillerys Melinda Han Williams Named to ADWEEKs AI Power 50
Technology

Dstillerys Melinda Han Williams Named to ADWEEKs AI Power 50

GlobeNews Wire
Last updated: 09/03/2026 10:38 PM
GlobeNews Wire
Published: 09/03/2026
Share
SHARE

Dstillery Chief Data Scientist recognized for AI innovation

March 09, 2026 12:52 ET  | Source: Dstillery, Inc.

NEW YORK, March 09, 2026 (GLOBE NEWSWIRE) — Dstillery, the leading AI ad targeting company, today announced that its Chief Data Scientist, Melinda Han Williams, Ph.D., has been named an honoree in ADWEEK’s 2026 AI Power 50.

“Melinda is the rare kind of leader who changes not just her company, but the direction of an entire industry,” said Michael Beebe, CEO of Dstillery. “She combines extraordinary technical expertise with a rare ability to make complex AI concepts accessible and actionable. This recognition from ADWEEK reflects both her groundbreaking innovation and the lasting impact she continues to have across the AI and marketing landscape.”

The AI Power 50 celebrates executives and innovators actively shaping how AI is applied, scaled, and embedded across the industry. This year’s honorees represent leaders turning artificial intelligence from emerging possibility into real-world, operational impact.

As Chief Data Scientist at Dstillery, Melinda has played a central role in advancing the practical use of AI in advertising by transforming complex machine learning systems into tools that operate directly within everyday marketing workflows. Over more than a decade at the company, she has led the development of Dstillery’s core AI platforms, including its Multimodal AI technology. Most recently, she led the creation of DS-1, an agentic AI platform that allows marketers to discover, build, and activate audiences through a single conversational system.

Rather than positioning AI as a separate tool, Melinda has focused on embedding intelligence directly into media teams’ workflows. Under her leadership, DS-1 performs real operational actions, evaluating signals, generating predictive models, and activating audiences across platforms in minutes rather than days. By transforming AI from a tool into an execution partner, she has helped agencies and brands confidently integrate AI into their everyday media operations. This shift from AI as an assistant to AI as an acting agent has helped accelerate adoption across agencies and brands, making AI a trusted and core component of modern marketing operations.

Beyond product innovation, Melinda is widely recognized as a thought leader in applied AI and Agentic. She is a frequent keynote speaker and panelist, known for translating advanced machine learning concepts into clear, actionable frameworks for marketers. In 2025, she led hands-on industry workshops where programmatic professionals built and deployed their first AI agents, and she is the architect behind the majority of Dstillery’s 25 AI-related patents.

Melinda continues to share her expertise across the industry, including speaking at The Female Quotient Lounge at POSSIBLE Miami this April, ADWEEK House at Cannes in June, and Advertising Week New York in October.

ABOUT DSTILLERY
Dstillery is the leading AI ad targeting company. We empower brands and agencies to target their best prospects for high-performing programmatic advertising campaigns. Our audience targeting solutions are powered by multimodal AI — a breakthrough in AI that learns from any form of data and applies it to any form of data, making it the most flexible targeting engine in the market. Backed by our award-winning Data Science, Dstillery has earned 25 patents (and counting) for the AI technology that powers our precise, scalable audiences. To learn more, visit us at www.dstillery.com or follow us on LinkedIn.

MEDIA CONTACT
Michael Vaughan
mvaughan@kcsa.com
(813) 210-1706

Fuel for Learning: Aschila’s Story
Perfios Partners with SatSure to Revolutionize the Agri-Lending with Earth Intelligence
Bybit Launches Fiat-to-Crypto Frenzy for New Users With 97,200 USDT Reward Pool
IIM Udaipur Partners with MoSPI, NITI Aayog, and Bhashini to Strengthen India’s Data, Monitoring, and AI Ecosystem
Algorand Foundation and Paycode Announce Partnership to Expand Financial Inclusion on Blockchain
TAGGED:adweeksdstilleryshanmelindanamednewspower,williams
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
ZTE Releases Sustainability Report 2024: Empowering a Sustainable Future through Digital Intelligence
Entertainment

ZTE Releases Sustainability Report 2024: Empowering a Sustainable Future through Digital Intelligence

PRNW Agency
PRNW Agency
09/06/2025
Avid Organics to Launch the World’s First Commercial-Scale Bio-Based Glycolic Acid, AviGa Bio HP70, at in-cosmetics Global in Paris
SteelPower Capsules for Male Enhancement Support: Review the Ingredients & Where to Buy to Avoid Complaints
Euro NCAP to Launch New 2025 Assisted Driving Results
Generate:Biomedicines to Initiate Global Phase 3 Studies of GB-0895, a Long-Acting Anti-TSLP Antibody for Severe Asthma Engineered with AI
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?