By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: Cloudera Recognized as a Leader in the IDC APAC MarketScape for Unified AI Platforms 2025 Vendor Assessment
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > Technology > Cloudera Recognized as a Leader in the IDC APAC MarketScape for Unified AI Platforms 2025 Vendor Assessment
Cloudera Recognized as a Leader in the IDC APAC MarketScape for Unified AI Platforms 2025 Vendor Assessment
Technology

Cloudera Recognized as a Leader in the IDC APAC MarketScape for Unified AI Platforms 2025 Vendor Assessment

GlobeNews Wire
Last updated: 12/09/2025 8:36 AM
GlobeNews Wire
Published: 12/09/2025
Share
SHARE

This recognition highlights the company’s strength in governance, security, and innovation

September 11, 2025 21:00 ET  | Source: Cloudera, Inc.


SINGAPORE, Sept. 11, 2025 (GLOBE NEWSWIRE) — Cloudera, the only company bringing AI to data anywhere, announced today that it has been named a Leader in the IDC APAC MarketScape for Unified AI Platforms 2025 vendor assessment. IDC highlighted Cloudera’s ability to deliver a comprehensive platform that integrates the latest generative AI and agentic workflows with enterprise-grade governance, security, and operational features.

“Being named a leader by IDC is a milestone that validates our vision of bringing AI to data anywhere,” said Remus Lim, Senior Vice President for Asia Pacific and Japan at Cloudera. “Enterprises today face the dual challenge of accelerating innovation while ensuring trust and compliance. Cloudera is uniquely positioned to help them achieve both, delivering the transparency, security, and scalability they need to responsibly adopt generative and agentic AI at scale.”

Cloudera’s platform is built to help organizations scale responsible AI in highly regulated and complex environments, supporting industries such as financial services, telecom, healthcare, and government. IDC noted Cloudera’s strengths in:

  • Governance and Security: Robust frameworks with fine-grained policies, audit trails, and compliance alignment.
  • Operational AI & Agentic Workflows: End-to-end capabilities spanning data engineering, MLOps/LLMOps, generative AI orchestration, and agentic workflows with built-in observability.
  • Innovation & Ecosystem: Expanded capabilities through strategic acquisitions (Verta, Octopai, Taikun) and strategic partnerships with NVIDIA, Cohere, Anthropic, Mistral, AWS (Bedrock), Dell, and CrewAI.
  • Accessibility: Low-code/no-code AI Studios enabling both technical and business users to build, deploy, and manage AI faster.

Every enterprise is under pressure to harness AI without compromising trust, security, or compliance. From financial institutions safeguarding sensitive data to healthcare providers deploying AI responsibly, organizations need a platform that balances speed with control. IDC’s recognition signals that Cloudera is one of the top choices to deliver that balance.

Cloudera continues to invest heavily in R&D, with nearly half its global workforce dedicated to engineering. This recognition follows a period of rapid innovation for the company, including the launch of Cloudera AI Workbench for building and deploying AI agents, Cloudera AI Inference for cost-efficient GenAI at scale, and expanded governance capabilities to ensure compliance and transparency across the AI lifecycle. Strategic acquisitions including Verta (operational AI), Octopai (automated data lineage), and Taikun (cloud-native infrastructure management) have further accelerated Cloudera’s ability to deliver AI to data anywhere.

The IDC MarketScape evaluates vendors on both capabilities and strategies, providing enterprises with a comprehensive view of the rapidly evolving AI platform market. The full report is available here.

About Cloudera
Cloudera is the only data and AI platform company that large organizations trust to bring AI to their data anywhere it lives. Unlike other providers, Cloudera delivers a consistent cloud experience that converges public clouds, data centers, and the edge, leveraging a proven open-source foundation. As the pioneer in big data, Cloudera empowers businesses to apply AI and assert control over 100% of their data, in all forms, delivering unified security, governance, and real-time predictive insights. The world’s largest organizations across all industries rely on Cloudera to transform decision-making and ultimately boost bottom lines, safeguard against threats, and save lives.

To learn more, visit Cloudera.com and follow us on LinkedIn and X. Cloudera and associated marks are trademarks or registered trademarks of Cloudera, Inc. All other company and product names may be trademarks of their respective owners.

Disclaimer: IDC MarketScape vendor assessments are designed to provide an overview of the competitive fitness of technology and service suppliers in a given market. The research utilizes a rigorous scoring methodology based on both qualitative and quantitative criteria that results in a single graphical illustration of each supplier’s position within a given market. IDC MarketScape provides a clear framework in which the product and service offerings, capabilities and strategies, and current and future market success factors of technology suppliers can be meaningfully compared. The framework also provides technology buyers with a 360-degree assessment of the strengths and weaknesses of current and prospective suppliers.

Contact
Jess Hohn-Cabana
cloudera@v2comms.com

Frost & Sullivan: OptiSigns Receives the 2025 North American SMB Digital Signage Product Leadership Recognition for Excellence in Digital Transformation and Customer Engagement
DAR GLOBAL AND ART DISTRICT REAL ESTATE DEVELOPMENT ANNOUNCE ‘MAD’, MUSCAT’S MARINE, ART & DIGITAL DISTRICT
Huawei and Industry Pioneers Unveil Over 30 Global Benchmark Showcases for Digital and Intelligent Transformation in the Data Communication Domain
Chainguard Launches Global Partner Program to Accelerate Trusted Open Source Software Adoption
Asia Tech x Singapore 2025 Recap
TAGGED:2025apacassessmentclouderaforidcleadermarketscapenewsplatformsrecognizedtheunifiedvendor
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
Press release: Transparency Notification from Shareholder
Health

Press release: Transparency Notification from Shareholder

GlobeNews Wire
GlobeNews Wire
13/10/2025
PART TWO: A DECADE OF VISION THE 10 MOST ICONIC GENESIS CONCEPT CARS
Hexaware Appoints Aditya Jayaraman (Adi) as Country Head, India
Lamborghini SC63 aims to finish on a positive note in IMSA GTP finale at Petit Le Mans
Binti Launches First-of-its-Kind “AI for Social Services” Offering with Anthropic, Unleashing AI to Its Customer Base of Agencies Serving 46% of Child Welfare Across the U.S.
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?