By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: Adstra Makes Conexa Composable Identity Solution Available Through Databricks Marketplace and Delta Sharing
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > Technology > Adstra Makes Conexa Composable Identity Solution Available Through Databricks Marketplace and Delta Sharing
Adstra Makes Conexa Composable Identity Solution Available Through Databricks Marketplace and Delta Sharing
Technology

Adstra Makes Conexa Composable Identity Solution Available Through Databricks Marketplace and Delta Sharing

GlobeNews Wire
Last updated: 11/06/2025 12:36 AM
GlobeNews Wire
Published: 11/06/2025
Share
SHARE

Integration furthers the mission of easy access through a modular approach

June 10, 2025 12:30 ET  | Source: Adstra

NEW YORK, June 10, 2025 (GLOBE NEWSWIRE) — Adstra, the leader in enterprise identity resolution across all media and marketing touchpoints, today announced the availability of its Conexa™ Enterprise Identity Platform within the Databricks Marketplace. This new integration leverages Delta Sharing to give marketers seamless, secure, and turnkey access to Adstra’s rich identity and consumer data.

Conexa is the industry’s first Composable Identity Platform, designed to address the dynamic and situational identity needs of today’s brands. By integrating with the Databricks Data Intelligence Platform, Adstra now empowers clients with unparalleled flexibility and control over their data strategies, truly embodying the evolution of composable identity.

“The identity landscape is incredibly varied, where brands need different capabilities and solutions in order to tailor their approach to their business,” said Andy Johnson, Chief Data & Product Officer. “Conexa’s composable capabilities make our solution portable and scalable, readily available to fill the gaps in the modern data stack. The Databricks Marketplace is a natural fit, because it makes Conexa available and as easy to use as possible.”

Through this integration, Databricks’ Delta Sharing solution eliminates the need for data replication, which is often costly, time-consuming, and introduces security risks. Customers can work directly with Databricks and Adstra to access specific tables and datasets, then query the shared data with their own tools.

By making the Conexa platform available in this fashion, Adstra clients can now quickly and easily access the precise identity data they need, on their own terms, without heavy lifting or custom integrations. With direct access to our comprehensive identity graph and consumer attributes, clients can realize the full potential of composable identity by enhancing their own customer insights, improving personalization efforts, and optimizing campaign performance across channels.

“We’re excited to have Adstra’s composable identity solution, Conexa, available within the Databricks Marketplace,” said Dan Morris, Global Head of Marketing Solutions GTM at Databricks. “Customers can now access Adstra’s rich identity data securely and in real time, eliminating the need for data replication or custom pipelines. This showcases the power of Delta Sharing, enabling brands to use the data they need, when and where they need it, to accelerate everything from audience segmentation to AI-driven personalization.”

Databricks Marketplace is an open marketplace that enables Databricks’ customers to easily discover and use data and AI assets from hundreds of leading providers. Powered by the open source Delta Sharing, Databricks Marketplace supports a host of assets, including structured data, unstructured files and volumes, machine learning models, and notebook applications.

About Adstra

Adstra is a leading provider of composable identity solutions, empowering brand marketers, advertising agencies, publishers and platforms with flexible, scalable options that seamlessly integrate within today’s data ecosystems. Adstra’s preconnected omnichannel identity graph and readily available digital audiences enable clients to recognize and engage customers across all touchpoints with unprecedented precision. By bridging fragmented data and comprehensive identity resolution needs, Adstra unlocks deeper customer insights, enhances personalization, and maximizes ROI across channels. Learn more about our identity solutions at www.adstradata.com.

Media contact:
Michelle Galvan
michelle.Galvan@adstradata.com

The Roadmap to Securing Your Own Digital Domain is Now Available
Mactores Signs Strategic AWS Partnership to Accelerate Enterprise GenAI Adoption by 80%
Bybit Explores 2026 Macro Volatility and Always-On Market Access
Beko Presents AI-Driven Smart Appliances, Advancing Sustainability and Consumer Convenience
New Year Special: Bybit Daily Treasure Hunt Kicks Off 2026 with Six Weeks of Rewards
TAGGED:adstraandavailablecomposableconexadatabricksdeltaidentitymakesmarketplacenewssharingsolutionthrough
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
Databricks Launches Free Edition and Announces 0 Million Investment to Develop the Next Generation of Data and AI Talent
News

Databricks Launches Free Edition and Announces $100 Million Investment to Develop the Next Generation of Data and AI Talent

12/06/2025
Residential Real Estate Buyer Brokerage Commissions Class Actions – Class Action Notice of Proposed Settlement and Ancillary Relief and Opt-Out Deadline
IFA UK Names Syed Javeed Shah, Resident of Abu Dhabi, UAE and Indian National, Among Top 5 Finalists for 2025 Member of the Year Award
Novartis breaks ground on new global Biomedical Research center in San Diego to accelerate drug discovery
Herbalife India Bags ‘Exceptional Employee Experience’ Title for Large-scale Enterprises
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?