By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: Shimadzu Asia Pacific Celebrates 150th Anniversary -A Century and a Half of Driving Healthcare and Technological Breakthroughs
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > News > Shimadzu Asia Pacific Celebrates 150th Anniversary -A Century and a Half of Driving Healthcare and Technological Breakthroughs
Shimadzu Asia Pacific Celebrates 150th Anniversary -A Century and a Half of Driving Healthcare and Technological Breakthroughs
News

Shimadzu Asia Pacific Celebrates 150th Anniversary -A Century and a Half of Driving Healthcare and Technological Breakthroughs

Last updated: 21/10/2025 10:36 AM
Published: 21/10/2025
Share
SHARE

SINGAPORE, Oct. 21, 2025 /PRNewswire/ — Shimadzu Asia Pacific joins the global celebration of Shimadzu Corporation‘s 150th anniversary, marking a century and a half of pioneering innovations that have shaped science, technology, and healthcare worldwide.

- Advertisement -

“As we celebrate 150 Years of Innovation, we remain committed to contributing to society through science and technology. Together with our partners, customers, and employees, we will continue developing solutions that address key challenges and create value across Asia Pacific and beyond,” said Prem Anand, Managing Director of Shimadzu Asia Pacific.

- Advertisement -

150 Years of Science, Healthcare, and Innovation

- Advertisement -

Shimadzu’s long history of innovation includes more than 9,000 patents, reinforcing its leadership in precision instrumentation. The company has also developed over 50 AI-powered features across its analytical and medical systems, including the world’s first robot-compatible autonomous laboratory system with LC-MS and the first AI-driven algorithm for chromatography peak detection, Peakintelligence™.

- Advertisement -

Beyond AI, Shimadzu continues to push boundaries with the high-precision optical lattice clock, which is the most accurate timekeeper ever developed and deviates by just one second over 30 billion years. The clock has real-world applications in earthquake detection, volcanic monitoring, and underground exploration.

- Advertisement -

Asia is entering what many call the Asian Century, marked by economic growth and technological development. Shimadzu Asia Pacific is supporting this progress with the opening of its first analytical factory in Bengaluru, India, in 2027. The factory will be Shimadzu’s first in the Asia Pacific region to produce mass spectrometers (MS), along with diverse range of advanced analytical instruments, including liquid chromatography (LC), gas chromatography (GC), and ultraviolet-visible (UV) spectrophotometers.

- Advertisement -

Partnerships in Healthcare and Inclusive Growth

- Advertisement -

Shimadzu Asia Pacific continues to advance healthcare through strategic partnerships, including the Singapore General Hospital-Shimadzu Personomics Centre, which is driving progress in personalized treatment; Shimadzu-Changi General Hospital Clinomics Centre (SC3) for LCMS-based hypertension testing; and the DxD Hub Diagnomics Centre.

- Advertisement -

The company is equally committed to diversity, equity, and inclusion, demonstrated through several community initiatives in Singapore, such as the ‘Love Our Seniors’ programme, blood donation drives, and waterway clean-ups. Regionally, 150 employees have pledged in 2025 to participate in these activities, symbolically marking Shimadzu’s 150th anniversary.

- Advertisement -

Building on its history of technological innovation, Shimadzu will continue to contribute to advances in health, sustainability, and science in the years ahead.

- Advertisement -

For more information about Shimadzu Asia Pacific’s 150th anniversary activities, please visit https://www.shimadzu.com.sg/an/news/150-anniversary-celebration.html

- Advertisement -

About Shimadzu Asia Pacific

- Advertisement -

Established in 1989, Shimadzu (Asia Pacific) proudly serves as the Asia headquarters for Shimadzu Corporation, a global leader in Analytical & Measuring Instruments and Medical Systems. Backed by 150 years of innovation, the company delivers leading-edge technologies, end-to-end solutions, and exceptional after-sales services, staying true to its mission to contribute to society through science and technology. With a dedicated workforce of over 500 employees across 5 subsidiaries in India, Malaysia, the Philippines, and Vietnam, and a presence in more than 18 countries, Shimadzu (Asia Pacific) is dedicated to meeting diverse customer needs.

- Advertisement -

Photo – https://mma.prnewswire.com/media/2796707/Photo_1_Shimadzu_India_Manufacturing.jpg

- Advertisement -

Photo – https://mma.prnewswire.com/media/2796708/Photo_2_Prem_Managing_Director_Shimadzu_Asia_Pacific.jpg

- Advertisement -

View original content:https://www.prnewswire.com/in/news-releases/shimadzu-asia-pacific-celebrates-150th-anniversary-a-century-and-a-half-of-driving-healthcare-and-technological-breakthroughs-302585240.html

- Advertisement -
NYSE Content Advisory: Pre-Market Update + NYSE Creates Tokenized Securities Platform for 24/7 Trading
Immuneering Appoints Dr. Thomas Schall as Chairman of the Board
World Hemophilia Day 2026 – April 17, 2026 – “Diagnosis: First step to care.”
The Kia PV5 Cargo crowned Van of the Year and Compact Van of the Year at the 2026 What Van? Awards
IIFL Home Finance Celebrates Green Homeowners in Bhuj
TAGGED:150thandanniversary:asiabreakthroughscelebratescenturydrivinghalfhealthcarenewspacific,shimadzutechnological
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
Department of Culture and Tourism – Abu Dhabi Announces Curatorial Team and Locations for Second Edition of Manar Abu Dhabi
News

Department of Culture and Tourism – Abu Dhabi Announces Curatorial Team and Locations for Second Edition of Manar Abu Dhabi

29/09/2025
Aptose Biosciences Announces Results of Reconvened Annual and Special Shareholders Meeting and Appointment of Ernst & Young LLP as New Auditor
BST Global Receives Frost & Sullivan’s 2025 Global AEC Project Management Company of the Year Award for Excellence in Market Leadership and Digital Transformation
BioNTech and DualityBios Antibody-Drug Conjugate Trastuzumab Pamirtecan Demonstrated Clinically Meaningful Efficacy in Patients with HER2-Expressing, Recurrent Endometrial Cancer
NYSE Content Advisory: Pre-Market Update + Wall Street digests August PCE data
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?