By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: Shimadzu Asia Pacific Celebrates 150th Anniversary -A Century and a Half of Driving Healthcare and Technological Breakthroughs
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > News > Shimadzu Asia Pacific Celebrates 150th Anniversary -A Century and a Half of Driving Healthcare and Technological Breakthroughs
Shimadzu Asia Pacific Celebrates 150th Anniversary -A Century and a Half of Driving Healthcare and Technological Breakthroughs
News

Shimadzu Asia Pacific Celebrates 150th Anniversary -A Century and a Half of Driving Healthcare and Technological Breakthroughs

Last updated: 21/10/2025 10:36 AM
Published: 21/10/2025
Share
SHARE

SINGAPORE, Oct. 21, 2025 /PRNewswire/ — Shimadzu Asia Pacific joins the global celebration of Shimadzu Corporation‘s 150th anniversary, marking a century and a half of pioneering innovations that have shaped science, technology, and healthcare worldwide.

- Advertisement -

“As we celebrate 150 Years of Innovation, we remain committed to contributing to society through science and technology. Together with our partners, customers, and employees, we will continue developing solutions that address key challenges and create value across Asia Pacific and beyond,” said Prem Anand, Managing Director of Shimadzu Asia Pacific.

- Advertisement -

150 Years of Science, Healthcare, and Innovation

- Advertisement -

Shimadzu’s long history of innovation includes more than 9,000 patents, reinforcing its leadership in precision instrumentation. The company has also developed over 50 AI-powered features across its analytical and medical systems, including the world’s first robot-compatible autonomous laboratory system with LC-MS and the first AI-driven algorithm for chromatography peak detection, Peakintelligence™.

- Advertisement -

Beyond AI, Shimadzu continues to push boundaries with the high-precision optical lattice clock, which is the most accurate timekeeper ever developed and deviates by just one second over 30 billion years. The clock has real-world applications in earthquake detection, volcanic monitoring, and underground exploration.

- Advertisement -

Asia is entering what many call the Asian Century, marked by economic growth and technological development. Shimadzu Asia Pacific is supporting this progress with the opening of its first analytical factory in Bengaluru, India, in 2027. The factory will be Shimadzu’s first in the Asia Pacific region to produce mass spectrometers (MS), along with diverse range of advanced analytical instruments, including liquid chromatography (LC), gas chromatography (GC), and ultraviolet-visible (UV) spectrophotometers.

- Advertisement -

Partnerships in Healthcare and Inclusive Growth

- Advertisement -

Shimadzu Asia Pacific continues to advance healthcare through strategic partnerships, including the Singapore General Hospital-Shimadzu Personomics Centre, which is driving progress in personalized treatment; Shimadzu-Changi General Hospital Clinomics Centre (SC3) for LCMS-based hypertension testing; and the DxD Hub Diagnomics Centre.

- Advertisement -

The company is equally committed to diversity, equity, and inclusion, demonstrated through several community initiatives in Singapore, such as the ‘Love Our Seniors’ programme, blood donation drives, and waterway clean-ups. Regionally, 150 employees have pledged in 2025 to participate in these activities, symbolically marking Shimadzu’s 150th anniversary.

- Advertisement -

Building on its history of technological innovation, Shimadzu will continue to contribute to advances in health, sustainability, and science in the years ahead.

- Advertisement -

For more information about Shimadzu Asia Pacific’s 150th anniversary activities, please visit https://www.shimadzu.com.sg/an/news/150-anniversary-celebration.html

- Advertisement -

About Shimadzu Asia Pacific

- Advertisement -

Established in 1989, Shimadzu (Asia Pacific) proudly serves as the Asia headquarters for Shimadzu Corporation, a global leader in Analytical & Measuring Instruments and Medical Systems. Backed by 150 years of innovation, the company delivers leading-edge technologies, end-to-end solutions, and exceptional after-sales services, staying true to its mission to contribute to society through science and technology. With a dedicated workforce of over 500 employees across 5 subsidiaries in India, Malaysia, the Philippines, and Vietnam, and a presence in more than 18 countries, Shimadzu (Asia Pacific) is dedicated to meeting diverse customer needs.

- Advertisement -

Photo – https://mma.prnewswire.com/media/2796707/Photo_1_Shimadzu_India_Manufacturing.jpg

- Advertisement -

Photo – https://mma.prnewswire.com/media/2796708/Photo_2_Prem_Managing_Director_Shimadzu_Asia_Pacific.jpg

- Advertisement -

View original content:https://www.prnewswire.com/in/news-releases/shimadzu-asia-pacific-celebrates-150th-anniversary-a-century-and-a-half-of-driving-healthcare-and-technological-breakthroughs-302585240.html

- Advertisement -
Hyundai Motor Group Executive Chair Euisun Chung and Chung Family Honored with Automotive News Centennial Award
Frost & Sullivan: Innovapptive Receives the 2026 Global Augmented Connected Worker, End-to-End Platforms Company of the Year Recognition for Excellence in AI-Powered Connected Worker Execution
Bid process for future FIS Junior World Championships in full swing
Aarti Industries Limited Secures USD 150 Million Medium-Term Supply Contract with Global Agrochemical Major
QualiZeal Receives Frost & Sullivan’s 2025 India Technology Innovation Leadership Recognition for Excellence in GenAI Quality Engineering Platforms
TAGGED:150thandanniversary:asiabreakthroughscelebratescenturydrivinghalfhealthcarenewspacific,shimadzutechnological
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
Swiggy and McDonald’s Join Hands to Launch the revolutionary McDonald’s Protein Plus Burgers exclusively on the Swiggy app
News

Swiggy and McDonald’s Join Hands to Launch the revolutionary McDonald’s Protein Plus Burgers exclusively on the Swiggy app

26/07/2025
New IBM Study Finds CIOs and CTOs Face Growing AI Control Gap as Enterprise Deployment Scales
CGTN: How cultural exchanges foster the China-Vietnam friendship
KuCoin Becomes the First Top Exchange to Achieve CCSS Certification, Setting a New Standard for Security and Trust in the Crypto Industry
LEX Diagnostics Receives FDA 510(k) Clearance and CLIA Waiver for LEX VELO System
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?