By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: Piramal Pharma Solutions Unveils State-of-the-Art Payload-Linker Suite at its Riverview, Michigan Facility
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > News > Piramal Pharma Solutions Unveils State-of-the-Art Payload-Linker Suite at its Riverview, Michigan Facility
Piramal Pharma Solutions Unveils State-of-the-Art Payload-Linker Suite at its Riverview, Michigan Facility
News

Piramal Pharma Solutions Unveils State-of-the-Art Payload-Linker Suite at its Riverview, Michigan Facility

Last updated: 14/05/2026 9:38 AM
Published: 14/05/2026
Share
SHARE
  • The Riverview facility provides comprehensive services for active pharmaceutical ingredients (APIs) and high potency APIs (HPAPIs), including specialized solutions for payload-linkers.
  • This cutting-edge suite will significantly enhance the company’s ability to support global payload-linker development and manufacturing and help partners bring complex therapies like antibody-drug conjugates (ADCs) and other bioconjugates to market.

MUMBAI, India, May 13, 2026 /PRNewswire/ — Piramal Pharma Solutions, a leading global Contract Development and Manufacturing Organization (CDMO) and part of Piramal Pharma Ltd. (NSE: PPLPHARMA) (BSE: 543635) (“PPS”), has officially unveiled a new, state-of-the-art payload-linker development and manufacturing suite at its Riverview, Michigan drug substance facility. This launch is a key element of the company’s broader $90 million investment plan to extend U.S.-based manufacturing capabilities, announced last year. In addition to the payload-linker suite, the plan will add new technology and enhanced commercial-scale manufacturing capabilities at PPS’s dedicated sterile injectables facility in Lexington, Kentucky. These strategic enhancements reinforce PPS’s commitment to bringing complex and innovative therapies to patients quickly and reliably.

- Advertisement -

“The launch of our new payload-linker suite at Riverview marks a major milestone for PPS and our partners,” said Peter DeYoung, CEO, Piramal Global Pharma. “The suite places world-class expertise, advanced technology, and commercial-scale payload-linker capabilities right here in Michigan, empowering our customers to accelerate the development and delivery of life-changing therapies, like ADCs. This investment demonstrates our deep commitment to U.S.-based innovation and manufacturing, ensuring our partners benefit from unmatched efficiency, supply chain security, and a seamless path from concept to clinic for these critical medicines.”

- Advertisement -

With over 60 years of drug substance development and manufacturing experience, Riverview is a distinguished leader in its field. Drawing on its diverse expertise, the site provides a comprehensive range of capabilities for APIs and HPAPIs. Leveraging its specialized HPAPI knowledge and abilities, Riverview serves as PPS’s dedicated payload-linker supplier, making it critical to ADCelerate™ – PPS’s rapid, integrated approach to phase I ADC development.

- Advertisement -

The addition of this payload-linker suite is designed to help PPS accelerate partners’ timelines and adapt to evolving market needs. Equipped with advanced containment, automation, and analytical technologies, the suite enables seamless scaling of payload-linker programs. This further strengthens the ADCelerate™ platform and positions PPS to meet the rising demand for ADCs and other bioconjugate therapies.

- Advertisement -

The expansions in Riverview and Lexington reinforce PPS’s position as the partner of choice for innovator companies looking for patient-centric, U.S.-based drug development and manufacturing solutions.

- Advertisement -

About Piramal Pharma Solutions

- Advertisement -

Piramal Pharma Solutions (PPS) is a Contract Development and Manufacturing Organization (CDMO) offering end-to-end development and manufacturing solutions across the drug life cycle. We serve our customers through a globally integrated network of facilities in North America, Europe, and Asia. This enables us to offer a comprehensive range of services including drug discovery solutions, process and pharmaceutical development services, clinical trial supplies, commercial supply of APIs, and finished dosage forms. We also offer specialized services such as the development and manufacture of highly potent APIs, antibody-drug conjugations, sterile fill/finish, peptide products and services, and potent solid oral drug products. PPS also offers development and manufacturing services for biologics including vaccines and gene therapies, made possible through Piramal Pharma Limited’s associate company, Yapan Bio Private Limited.

- Advertisement -

For more information visit: Piramal Pharma Solutions | LinkedIn| Facebook | X

- Advertisement -

About Piramal Pharma Limited

- Advertisement -

Piramal Pharma Limited (PPL) (NSE: PPLPHARMA) (BSE: 543635), offers a portfolio of differentiated products and services through its 17* global development and manufacturing facilities and a global distribution network in over 100 countries. PPL includes Piramal Pharma Solutions (PPS), an integrated contract development and manufacturing organization; Piramal Critical Care (PCC), a complex hospital generics business; and the Piramal Consumer Healthcare business, selling over-the-counter consumer and wellness products. In addition, one of PPL’s associate companies, Abbvie Therapeutics India Private Limited, a joint venture between Abbvie and PPL, has emerged as one of the market leaders in the ophthalmology therapy area in the Indian pharma market. Further, PPL has a strategic minority investment in Yapan Bio Private Limited, that operates in the biologics / bio-therapeutics and vaccine segments.

- Advertisement -

For more information, visit: Piramal Pharma | LinkedIn

- Advertisement -

Photo: https://mma.prnewswire.com/media/2979255/PPS_Ribbon_Cutting.jpg
Logo: https://mma.prnewswire.com/media/1726186/5968626/Piramal_Pharma_Solutions_Logo.jpg

- Advertisement -

 

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/piramal-pharma-solutions-unveils-state-of-the-art-payload-linker-suite-at-its-riverview-michigan-facility-302771114.html

- Advertisement -
Admissions Open for IIM Udaipur’s Executive MBA (EMBA) Program
HeatGov Project Begins Public Rollout of Infrastructure-Focused Blockchain Initiative
ProPlaintiff.ai Launches Agentic AI Platform for Personal Injury Attorneys
Recognify Life Sciences Provides Update on Phase 2b Trial of Inidascamine in Patients with Cognitive Impairment Associated with Schizophrenia
Xinhua Silk Road: Chinese tea embraces new opportunities shared by the world
TAGGED:facilityitsmichigannewspayload-linkerpharmapiramalriverview,solutionsstate-of-the-artsuiteunveils
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
GAC to Host European Premiere of the AION UT in Milan
News

GAC to Host European Premiere of the AION UT in Milan

10/04/2026
Zenara Pharma Receives U.S. FDA Approval for First Generic of Sertraline Hydrochloride Capsules with 180-Day CGT Exclusivity
Angelalign Technology Denies Patent Infringement and Vows Vigorous Defense
India Pitches Built Environment as the Next Global Investment Frontier at Davos 2026: The Urban Vision
The/Nudge Foundation Opens the*spark | Pullur Centre, Shared Startup Space for Social Entrepreneurs
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?