By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: NYSE Content Advisory: Pre-Market Update + ‘Taking Stock’ Series launches before Closing Bell
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > News > NYSE Content Advisory: Pre-Market Update + ‘Taking Stock’ Series launches before Closing Bell
News

NYSE Content Advisory: Pre-Market Update + ‘Taking Stock’ Series launches before Closing Bell

Last updated: 19/08/2025 2:37 AM
Published: 19/08/2025
Share
SHARE

NEW YORK, Aug. 18, 2025 /PRNewswire/ — The New York Stock Exchange (NYSE) provides a daily pre-market update directly from the NYSE Trading Floor. Access today’s NYSE Pre-market update for market insights before trading begins. 

- Advertisement -

Ashley Mastronardi delivers the pre-market update on August 18th

- Advertisement -
  • Stocks are fractionally lower following another winning week for the major averages. The DOW rose by 1.7% while the S&P 500 finished higher for the fourth time in the past five weeks.
  • The Federal Reserve will be in focus as the Central Bank heads to Jackson Hole, Wyoming, for its annual economic policy symposium. Chair Powell will deliver remarks on Friday.
  • Later today, the NYSE will launch a new show at the closing bell called Taking Stock. In collaboration with Money20/20, FINTECH TV, and Cheddar. the show will launch just before 4 PM ET and will include experts on the trading floor.

Opening Bell
Make-A-Wish rings the Opening Bell

- Advertisement -

Closing Bell
Celebrating the launch of Taking Stock, a new closing bell show at the NYSE

- Advertisement -

Click here to download the NYSE TV App

- Advertisement -

Video – https://mma.prnewswire.com/media/2752497/NYSE_Market_Update_August_18.mp4 
Logo – https://mma.prnewswire.com/media/2581322/5464386/New_York_Stock_Exchange_Logo.jpg

- Advertisement -

 

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/nyse-content-advisory-pre-market-update–taking-stock-series-launches-before-closing-bell-302532235.html

- Advertisement -
EquiLend and ISLA Americas Release 2025 Latin America Securities Finance User Guide
adidas and the Future Audi F1 Team Announce MultiYear Partnership
Tony Hawk’s Historic “900” Skateboard Headlines Major Skate Sale at Julien’s Auctions
Benefits Reimagined Unveils AI-Powered ACA Application on SAP BTP
25 Years of Value Creation: Dun & Bradstreet Honors India’s Top 500 Value Creators 2025
TAGGED:‘takingadvisorybeforebell,closingcontentlaunchesnewsnysepre-marketseriesstockupdate
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
IBM Power11 Raises the Bar for Enterprise IT
News

IBM Power11 Raises the Bar for Enterprise IT

10/07/2025
Vivani Medical, Inc. Announces Pricing of Common Stock Offering
Local Operations and Regional Integration: Topband’s India Facility Powers Ahead
AirHelp Launches First Unlimited, Free Flight-Tracking App for Passengers
ArkBio Initiates Phase II Clinical Trial of AK0610, a Preventive Monoclonal Antibody for Respiratory Syncytial Virus Infection
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?