By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: NYSE Content Advisory: Pre-Market Update + S&P 500 To End 2025 Trade This Week, Up 18% So Far This Year
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > Entertainment > NYSE Content Advisory: Pre-Market Update + S&P 500 To End 2025 Trade This Week, Up 18% So Far This Year
Entertainment

NYSE Content Advisory: Pre-Market Update + S&P 500 To End 2025 Trade This Week, Up 18% So Far This Year

PRNW Agency
Last updated: 29/12/2025 10:36 PM
PRNW Agency
Published: 29/12/2025
Share
SHARE

NEW YORK, Dec. 29, 2025 /PRNewswire/ — The New York Stock Exchange (NYSE) provides a daily pre-market update directly from the NYSE Trading Floor. Access today’s NYSE Pre-market update for market insights before trading begins. 

- Advertisement -

Kristen Scholer delivers the pre-market update on December 29th

- Advertisement -
  • Stocks are steady as Wall Street enters the final trading days of 2025 in a holiday-shortened week; markets close on New Year’s Day and economic data will be light.
  • S&P 500 up 18% YTD, fueled by lower rates, strong earnings, and economic resilience; the index hit a record high last week and logged its best weekly gain in a month.
  • Investors eye Santa Claus rally—the last five sessions of the year plus two in January—while Fed meeting minutes on Tuesday may offer clues on future borrowing costs.

Opening Bell
Third Street Music School Settlement rings the Opening Bell

- Advertisement -

Closing Bell
Knorex (NYSE American: KNRX) celebrates its recent listing

- Advertisement -

Click here to download the NYSE TV App

- Advertisement -

Video – https://mma.prnewswire.com/media/2852383/NYSE_market_update_Dec_29.mp4 
Logo – https://mma.prnewswire.com/media/2581322/5696973/New_York_Stock_Exchange_Logo.jpg

- Advertisement -

 

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/nyse-content-advisory-pre-market-update–sp-500-to-end-2025-trade-this-week-up-18-so-far-this-year-302650160.html

- Advertisement -
NYSE Content Advisory: Pre-Market Update + Inaugural U.S.-Saudi Biotech Alliance Summit Begins in SF
Automechanika Ho Chi Minh City 2025 opens tomorrow
Cutis Consumer Launches Protein Bar at Rs. 20 to Make Everyday Nutrition Accessible Across India
Crocs teams up with Rashmika Mandanna and popular creators to turn the festive season into an unfiltered celebration of joy
FY Energy Launches BTC Cloud Computing Contracts Backed by Green Energy as Institutional Demand Surges
TAGGED:18,2025500advisorycontentendfarnewsnysepre-markets&pthistradeupdateweekyear
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
MemoPryl Under Investigation (2026 Official Website Scam WARNING Update) Avoid Fake Complaints & Hidden Risks
Health

MemoPryl Under Investigation (2026 Official Website Scam WARNING Update) Avoid Fake Complaints & Hidden Risks

GlobeNews Wire
GlobeNews Wire
01/05/2026
LEPAS Elegant Technology, Defined by You: LEPAS Fun Test Drive Interprets a New Paradigm for Intelligent Driving via User Co-Creation
Aditya A. Shriram elected as President & Prashant J. Mahale elected as Vice President of AMAI
StockGro Launches Stoxo: India’s First Stock Market AI Research Platform That Turns Confusion into Conviction
F1 TITLE TO BE DECIDED AT 2025 ABU DHABI GRAND PRIX
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?