By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: NYSE Content Advisory: Pre-Market Update + NYSE Hosts 102nd Annual Tree Lighting
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > News > NYSE Content Advisory: Pre-Market Update + NYSE Hosts 102nd Annual Tree Lighting
News

NYSE Content Advisory: Pre-Market Update + NYSE Hosts 102nd Annual Tree Lighting

Last updated: 04/12/2025 7:36 PM
Published: 04/12/2025
Share
SHARE

NEW YORK, Dec. 4, 2025 /PRNewswire/ — The New York Stock Exchange (NYSE) provides a daily pre-market update directly from the NYSE Trading Floor. Access today’s NYSE Pre-market update for market insights before trading begins. 

- Advertisement -

Kristen Scholer delivers the pre-market update on December 4th

- Advertisement -
  • The NYSE hosts its 102nd annual tree lighting beginning at 3:30 PM ET today, featuring performances by Deborah Cox and Kelsie Watts, with Hank Azaria and NYSE President Lynn Martin lighting the 75-foot spruce around 6 PM ET.
  • Stocks are little changed this morning as the S&P 500 consolidates recent gains after rising in seven of the past eight sessions.
  • Rates are expected to be cut at the next Fed Meeting as markets see close to a 90% chance the Federal Reserve will lower interest rates next week.

Opening Bell
New America Acquisition Corp rings the Opening Bell

- Advertisement -

Closing Bell
The NYSE celebrates the 102nd annual tree lighting

- Advertisement -

Click here to download the NYSE TV App

- Advertisement -

Video – https://mma.prnewswire.com/media/2838721/NYSE_Market_Update_Dec_4.mp4
Logo – https://mma.prnewswire.com/media/2581322/5656394/New_York_Stock_Exchange_Logo.jpg

- Advertisement -

 

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/nyse-content-advisory-pre-market-update–nyse-hosts-102nd-annual-tree-lighting-302633139.html

- Advertisement -
NYSE Content advisory: Pre-Market update + S&P 500 Tops 6,500 for First Time
Linglong Tire’s 50th Anniversary Celebration Successfully Held in Madrid
Igyxos Biotherapeutics Announces Positive Results from Phase 1 Trial of IGX12, its First-in-Class Monoclonal Antibody for the Treatment of Male and Female Infertility
AppliedHE Launches First-Ever Asia Ranking to Recognise Both Public and Private Universities – with Student Voices at the Core
CLEAR, an Official TSA PreCheck Enrollment Provider, Expands Enrollment and Renewal Options by Opening a New Location at Aventura Mall in South Florida
TAGGED:102ndadvisoryannualcontenthosts,lightingnewsnysepre-markettreeupdate
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News

NEXEN TIRE Unveils NFERA Supreme EV ROOT Bridging EV and ICE with One Universal Fit

TheNews Market
TheNews Market
05/08/2025
Tamil Nadu Among India’s Most Insurance-Aware Markets: 100% Awareness, 70% Ready to Buy Life Insurance Soon
Why High-Net-Worth Investors Are Turning to BTC Miner for Daily Crypto Returns Amid Market Turbulence
LBB Specialties Expands Distribution Partnership with Clariant to Support Puerto Rico’s Life Sciences Market
Altair to Showcase AI-Powered Engineering, Smart Manufacturing, and Connected Defense Solutions at DSEI 2025
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?