By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: LifeSpan Portfolio Company Remedium Signs Landmark Deal with Eli Lilly
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > News > LifeSpan Portfolio Company Remedium Signs Landmark Deal with Eli Lilly
LifeSpan Portfolio Company Remedium Signs Landmark Deal with Eli Lilly
News

LifeSpan Portfolio Company Remedium Signs Landmark Deal with Eli Lilly

Last updated: 23/09/2025 10:37 PM
Published: 23/09/2025
Share
SHARE

NORWALK, Conn., Sept. 23, 2025 /PRNewswire/ — Lifespan Vision Ventures is pleased to announce that its portfolio company, Remedium Bio, Inc. (“Remedium”), has entered into a multi-target research and development collaboration with Eli Lilly and Company (“Lilly”) focused on advancing innovative gene therapies for Type 2 diabetes and obesity.

- Advertisement -

This partnership underscores the promise of Remedium’s proprietary Prometheus™ platform and the company’s leadership in developing long-acting, adjustable-dose therapeutics for major unmet medical needs. This approach aims to replace repeated protein-based injections with a safer, more consistent, and more cost-effective treatment, enabling genetic medicine to address common conditions across endocrinology, immunology, and cardiometabolic disease safely, effectively, and at scale.

- Advertisement -

“We congratulate Frank and the Remedium team on this important milestone with Lilly,” said Andrew Worden, Founding Partner at Lifespan Vision Ventures. “It is a powerful validation of their platform and is an important step toward developing interventions that extend healthspan. We’re excited to support Remedium as they scale their platform and translate it into therapies that can benefit millions of patients.”

- Advertisement -

About Remedium Bio

- Advertisement -

Remedium Bio is advancing a new generation of gene therapies to address major unmet medical needs across endocrinology, immunology, neurology, and musculoskeletal diseases. Its proprietary Prometheus™ platform enables long-lasting, adjustable-dose delivery of therapeutic genes through a single subcutaneous injection. This approach has the potential to replace many protein-based treatments at significantly lower cost, while offering patients safe, durable, and tunable control over therapeutic protein expression. Remedium’s pipeline includes multiple programs with the potential to meaningfully reshape the treatment landscape for conditions such as obesity and Type 2 diabetes.

- Advertisement -

For more information, visit: www.remedium-bio.com

- Advertisement -

About LifeSpan Vision Ventures

- Advertisement -

Lifespan Vision Ventures is a forward-thinking venture capital firm specializing in investments within the aging and longevity space. Our mission is to support and accelerate the development of innovative therapies that extend healthspan, improve quality of life as individuals age, and address age-related challenges. Through strategic partnerships and investments, we aim to shape a future where advances in science and technology prevent, delay, and treat age-related diseases; ultimately enabling healthier, longer lives.

- Advertisement -

Contact: info@lifespanvision.com

- Advertisement -

Logo – https://mma.prnewswire.com/media/1780796/LifeSpan_Vision_Ventures_Logo.jpg 

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/lifespan-portfolio-company-remedium-signs-landmark-deal-with-eli-lilly-302564703.html

- Advertisement -
Ski Jumping: yellow and red card sanctions among changes to be introduced for equipmentrelated infractions in 2025/26
Crypto.com Traders Gain Deeper Market Visibility Through Benzinga Data Integration
Beko Presents AI-Driven Smart Appliances, Advancing Sustainability and Consumer Convenience
ROE Visual Celebrates 20 Years of Pioneering LED Technology
“As Bitcoin Surpasses $123,000, ABQuant Users’ Daily Earnings Rise to $12,900”
TAGGED:companydealelilandmarklifespanlillynewsportfolioremediumsignswith
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
Intas & Accord signs Agreement to acquire Prothya Biosolutions
News

Intas & Accord signs Agreement to acquire Prothya Biosolutions

12/08/2025
HDFC Life and Northern Arc Capital Enter into a Strategic Partnership, Offering Financial Security to Customers
Fireplace Raises $1.5M to Build Institutional Trading Infrastructure for Prediction Markets
Masa Draws the Sea Again
ACTFORE Secures Patent for Template Identification and Matching Technology, Transforming Large-Scale Document Analysis in Breach Response
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?