By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: Levanta Acquires Perch+, Expanding Its Affiliate Marketplace with Hundreds of Amazon Sellers and Publishers
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > Technology > Levanta Acquires Perch+, Expanding Its Affiliate Marketplace with Hundreds of Amazon Sellers and Publishers
Levanta Acquires Perch+, Expanding Its Affiliate Marketplace with Hundreds of Amazon Sellers and Publishers
Technology

Levanta Acquires Perch+, Expanding Its Affiliate Marketplace with Hundreds of Amazon Sellers and Publishers

GlobeNews Wire
Last updated: 06/04/2026 5:37 PM
GlobeNews Wire
Published: 06/04/2026
Share
SHARE

The acquisition accelerates Levanta’s marketplace growth and gives Perch+’s sellers and publishers access to modern affiliate infrastructure

April 06, 2026 08:00 ET  | Source: Levanta


SEATTLE, April 06, 2026 (GLOBE NEWSWIRE) — Levanta, the leading affiliate and creator platform for e-commerce, today announced the acquisition of Perch+, one of the earliest affiliate networks built specifically for Amazon sellers. Perch+’s network of sellers and affiliate partners will now operate within Levanta, giving them access to a modern affiliate and creator platform built for e-commerce.

Levanta is acquiring Perch+ at a time of significant momentum, having grown 60% since last year. In 2026 alone, it has expanded its platform to support unified affiliate and creator programs across Amazon, Shopify, and Walmart, and introduced Paid Placements, which enables brands to secure flat-rate creator deals with affiliate-level performance measurement. The acquisition of Perch+’s sellers and affiliate network is the latest step in that momentum, further strengthening Levanta’s position as the leading platform for affiliate and creator-driven e-commerce.

“Perch+ built meaningful traction with Amazon sellers early on when very few affiliate platforms were focused on their needs,” said Ian Brodie, CEO and Co-Founder of Levanta. “By bringing this network into Levanta, we’re expanding opportunity on both sides of the marketplace — more brands for creators, and more creator-driven growth for brands.”

For Perch+ brands, the move to Levanta represents a significant upgrade in capability, enabling them to work directly with 60,000+ vetted partners in Levanta’s Marketplace, with advanced tooling for creator recruitment at scale and full support for Amazon Attribution and Creator Connections. Brands can also run Paid Placement campaigns, automate Product Sampling, and surface who is already talking about their brand across social, all from a single system.

For creators and publishers, the transition brings more than just a new platform. Levanta’s platform offers improved tracking, faster payouts, and a more centralized place to manage partnerships. Creators gain access to a significantly expanded roster of brands and greater earning opportunities, giving them more ways to land paid campaigns, earn performance-based commissions, and get products into their hands to create content.

“We built Perch+ to help Amazon brands tap into affiliate marketing as a meaningful growth channel,” said Jason Baer, chief marketing officer at Infinite Commerce, parent company of Perch+. “Levanta has built the platform and scale to take that vision much further. We’re excited to see the network continue to grow within Levanta.”

Perch+’s brands and creators can begin accessing Levanta starting as early as today. To learn more, visit Levanta.io.

About Levanta
Levanta is the unified creator and affiliate platform built for modern e-commerce. It enables brands and agencies to run one revenue-driving partnership program across Shopify, Amazon and Walmart, from discovery to payout, within a single system. Through its AI-powered Creator Marketplace, Levanta connects brands with high-performing publishers, influencers and affiliates while delivering complete visibility, incentive control, and cross-channel performance measurement. To find out more about Levanta, please visit https://levanta.io/.

Media Contact
Rachel Jermansky, SVP of Public Relations
rachel@samsonpr.com

Hankook’s iON Race Supports Competitive Racing at Historic Madrid E-Prix
QSC Receives Frost & Sullivan’s 2025 Global Technology Innovation Leadership Award for Pioneering Innovation in AV Communications
The largest pharma show in Asia makes its return to Shanghai this June 2026
Second Edition of Art de Vivre la franaise to be unveiled at India Design ID 2026
Haier Named the World’s Only IoT Ecosystem Brand in Kantar BrandZ Top 100 for Eight Consecutive Years
TAGGED:acquiresaffiliateamazonandexpandinghundredsitslevantamarketplacenewsperch+,publisherssellerswith
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
EquiLend and ISLA Americas Release 2025 Latin America Securities Finance User Guide
News

EquiLend and ISLA Americas Release 2025 Latin America Securities Finance User Guide

15/10/2025
HTX Earn Fully Upgraded: Join HTX Earn Carnival, Earn Up to 15% APY and Apple Product Rewards
HTX Launches “$1 Margin Trade”: Start Trading with Just 1 USDT, Enjoy Guaranteed First-Loss Coverage, Plus Share $40,000 in Rewards
Rhythm Pharmaceuticals, Inc. Announces Proposed Public Offering of Common Stock
Best Ipamorelin vs Sermorelin: Growth Hormone Peptide Comparison 2026 ReadyRx Prescription Telehealth Analysis
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?