By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: KFSH Leads Globally in Paired Kidney Transplants Performed at a Single Center in 2025
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > Health > KFSH Leads Globally in Paired Kidney Transplants Performed at a Single Center in 2025
KFSH Leads Globally in Paired Kidney Transplants Performed at a Single Center in 2025
Health

KFSH Leads Globally in Paired Kidney Transplants Performed at a Single Center in 2025

GlobeNews Wire
Last updated: 15/03/2026 6:41 PM
GlobeNews Wire
Published: 15/03/2026
Share
SHARE

RIYADH, Saudi Arabia, March 13, 2026 (GLOBE NEWSWIRE) — King Faisal Specialist Hospital and Research Centre (KFSH) achieved a global milestone by recording the highest number of kidneys paired donation transplants performed at a single center worldwide, completing 130 transplants in 2025. This figure surpassed the total performed transplants across 23 centers in Canada, which reached 73 transplants, as well as the highest-volume single center in the United States, which carried out 94 during the same period.

The achievement reflects the steady growth of the program since its launch in 2016, bringing the cumulative number of kidneys paired transplants performed under the program to 691 by the end of 2025, positioning it among the leading single-center kidney transplant initiatives globally.

This success was driven by a fully integrated operational model within one center, combining advanced immunology laboratory capabilities for precise compatibility testing, a coordinated system for managing complex exchange chains, and multidisciplinary clinical teams including transplant physicians and surgeons, anesthesiologists, transplant coordinators, nursing staff, and histocompatibility laboratory specialists. Together, they execute simultaneous procedures with high efficiency while maintaining patient safety at every stage of care.

The kidney paired donation program represents an innovative solution that expands access to transplantation by enabling kidney exchanges among patients whose blood types or tissue profiles are incompatible with their original donors. Through structured donor exchanges, patients are matched with more compatible donors, providing a pathway to transplantation for many who otherwise struggle to find suitable matches.

It is worth noting that King Faisal Specialist Hospital and Research Centre was ranked first in the Middle East and North Africa and 12th globally among the world’s top 250 academic medical centers for 2026. It was also recognized as the most valuable healthcare brand in the Kingdom and the Middle East by Brand Finance in 2025, and was listed by Newsweek among the World’s Best Hospitals 2025, the World’s Best Smart Hospitals 2026, and the World’s Best Specialized Hospitals 2026.

Contact information:
kfshrc@mcsaatchi.com

A photo accompanying this announcement is available at https://www.globenewswire.com/NewsRoom/AttachmentNg/ef6c16e7-4f80-49d7-9809-6cdbe0be6b5e

Haleon partners with Indian Dental Association to inaugurate the first D20 International Symposium
Synechron Opens Melbourne Office to Support Rapid Growth in Australia
Sentient Digital, Inc. (SDi) Partners with Viasat to Support Korea Coast Guard Maritime Domain Awareness and Information Sharing Missions
QStory Receives Frost & Sullivan’s 2025 European Workforce Management Enabling Technology Leadership Recognition
Tensive publishes positive long-term clinical follow-up data in Breast Cancer on REGENERA / SOFTAG breast implant
TAGGED:2025centergloballykfshkidneyleadsnewspairedperformedsingletransplants
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
ROLLER’s 2025 Pulse Report Reveals Consumer Spending Plans and Preferences
News

ROLLER’s 2025 Pulse Report Reveals Consumer Spending Plans and Preferences

11/07/2025
Embolx Launches Sniper G3: Revolutionizing Embolization with Enhanced Efficiency, Ease of Use, and Extended Shelf Life
Midea Showcases Transformative Innovations for ‘Master Your Home’ at IFA 2025
Bigg Boss 19 Episode 33 Review: Awez’s Task, Tanya–Kunika Clash, Nehal’s Entry and Gaurav as New Captain
Blockchain for Good Alliance (BGA) and FLock.io Enter Strategic Partnership to Advance “Blockchain and AI for Good”
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?