By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: Herbalife India Launches New Episode of Its Flagship Podcast Featuring Paralympian Palak Kohli Live Your Best Life, Unscripted: A Story of Grit, Purpose & Sporting Excellence
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > News > Herbalife India Launches New Episode of Its Flagship Podcast Featuring Paralympian Palak Kohli Live Your Best Life, Unscripted: A Story of Grit, Purpose & Sporting Excellence
Herbalife India Launches New Episode of Its Flagship Podcast Featuring Paralympian Palak Kohli Live Your Best Life, Unscripted: A Story of Grit, Purpose & Sporting Excellence
News

Herbalife India Launches New Episode of Its Flagship Podcast Featuring Paralympian Palak Kohli Live Your Best Life, Unscripted: A Story of Grit, Purpose & Sporting Excellence

Last updated: 11/12/2025 12:36 AM
Published: 11/12/2025
Share
SHARE

Champion Palak Kohli Details Her Journey of Mental Fortitude on the New Episode of Herbalife India’s Podcast: Live Your Best Life, Unscripted

- Advertisement -

Palak Kohli Shares Her Journey of Mental Strength on the New Episode of Herbalife India’s Podcast Live Your Best Life, Unscripted

- Advertisement -

BENGALURU, India, Dec. 10, 2025 /PRNewswire/ — Herbalife India has released a powerful new episode of its flagship wellness podcast Live Your Best Life, Unscripted, hosted by Ajay Khanna, Managing Director of Herbalife India. This episode spotlights world-ranked para-badminton star Palak Kohli, whose story continues to inspire millions.

- Advertisement -

Palak opens up about her early challenges growing up with a limb difference and how discovering badminton transformed her life. Today, she is an international medalist and India’s pride on the global stage, proving that limitations are only as powerful as one allows them to be.

- Advertisement -

“Sport gave me strength. It taught me to own who I am,” she shares. “The tougher the challenge, the stronger I become.”

- Advertisement -

Key themes in the episode include:

- Advertisement -
  • Road to the Paralympics and future ambitions
  • Commitment to fitness, nutrition, and mental toughness
  • Breaking barriers for women and para-athletes in India
  • Advocating for inclusivity and equal opportunities in sports

The episode highlights Herbalife India’s unwavering commitment to athlete development, performance nutrition, and inspiring communities to live with purpose.

- Advertisement -

Watch Now
YouTube: https://www.youtube.com/watch?v=hUbv6D2rqUI

- Advertisement -

Also streaming on:

- Advertisement -
  • Spotify: https://open.spotify.com/episode/6eVSLNiQVtB5PlXCF0qVFN?si=b5ffd780d7454149
  • Apple Podcasts: https://podcasts.apple.com/us/podcast/the-power-within-building-mental-resilience-for/id1808386057?i=1000739834836
  • Amazon Music: https://music.amazon.com/podcasts/a53233b6-84b5-43ce-a34a-5230c769168b/episodes/660ab985-6b0b-47e0-b0af-cd9e5ef498fc/live-your-best-life-unscripted-the-power-within-building-mental-resilience-for-success-ft-palak-kohli-live-your-best-life-unscripted

Herbalife (NYSE: HLF) is a premier health and wellness company, community and platform that has been changing people’s lives with great nutrition products and a business opportunity for its independent distributors since 1980. The Company offers science-backed food products to consumers in more than 90 markets through entrepreneurial distributors who provide one-on-one coaching and a supportive community that inspires their customers to embrace a healthier, more active lifestyle to live their best life.

- Advertisement -

Photo: https://mma.prnewswire.com/media/2842535/Herbalife_India_Podcast.jpg
Logo: https://mma.prnewswire.com/media/2238437/5664986/Herbalife_Logo.jpg

- Advertisement -

 

- Advertisement -

View original content to download multimedia:https://www.prnewswire.com/in/news-releases/herbalife-india-launches-new-episode-of-its-flagship-podcast-featuring-paralympian-palak-kohli-live-your-best-life-unscripted-a-story-of-grit-purpose–sporting-excellence-302637832.html

- Advertisement -
KuCoin Australia MD James Pinch at DECON 2026: Exchanges Are Becoming the Infrastructure Behind Everyday Commerce
ArkBio Initiates Phase II Clinical Trial of AK0610, a Preventive Monoclonal Antibody for Respiratory Syncytial Virus Infection
ADFW 2025: World’s Financial Elite Managing Over USD 60 Trillion to Explore How Technology is Shaping Finance
Apexon Unveils AgentRise, a Next-Gen Agentic AI Platform for Intelligent Enterprises
E-GetS Scales User Engagement Across SEA with EngageLabs Omnichannel AppPush & WhatsApp Business Solutions
TAGGED:bestepisodeexcellencefeaturingflagshipgritherbalifeindiaitskohlilauncheslifelivenewnewspalakparalympianpodcastpurposesportingstoryunscriptedyour
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
Neowave Academy Scales Global Web3 Education Initiative with Strategic Community Partnerships
News

Neowave Academy Scales Global Web3 Education Initiative with Strategic Community Partnerships

28/06/2025
Vantage Foundation Donates HK$1 Million to Support Residents Affected by Hong Kong Fire
CIIF 2025: Shanghai Electric Empowers Global Energy and Industrial Supply Chain Resilience with Frontier Innovations
New Crypto Mutuum Finance (MUTM) Announces V1 Protocol as Investor Count Tops 17,400
Astrall Dynamics Unveils Integrated Quadruped Firefighting Robot Hypertron-T01 at INTERSCHUTZ 2026
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?