By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: Bybit & Block Scholes Report: Markets Surge Past $4 Trillion as Regulatory Wins Drive Record Highs
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > News > Bybit & Block Scholes Report: Markets Surge Past $4 Trillion as Regulatory Wins Drive Record Highs
Bybit & Block Scholes Report: Markets Surge Past  Trillion as Regulatory Wins Drive Record Highs
News

Bybit & Block Scholes Report: Markets Surge Past $4 Trillion as Regulatory Wins Drive Record Highs

Last updated: 25/07/2025 7:36 PM
Published: 25/07/2025
Share
SHARE

DUBAI, UAE, July 25, 2025 /PRNewswire/ — Bybit, the world’s second-largest cryptocurrency exchange by trading volume, has released its latest crypto derivatives analytics report with Block Scholes, diving into a momentous “Crypto Week” in bullish territories. Crypto’s total market cap exceeded $4 trillion for the first time, driven by a combination of legislative advancements in the US and investor enthusiasm from BTC to altcoins.

- Advertisement -

Key Insights:

- Advertisement -
  • Altcoins Regained Favor: Following BTC’s initial surge, traders’ growing risk appetite started to spill over to altcoins. With ETH and SOL breaking barrier levels in the decisive week, widespread gains across the altcoin space uplifted the total crypto market cap to a historic high. This altcoin rally contributed to BTC dominance falling below 60% as investors diversified across the digital asset spectrum.
  • ETH Calls Over Puts: ETH options trading has become heavily skewed toward bullish positions, with call options dominating both volume and open interest metrics. The volatility term structure has compressed to a tight 64-65% range, while call skew peaked at 11%, reflecting strong directional conviction among institutional traders.
  • ETH Funding Rates Are Remarkably Strong: ETH spot price had more than doubled since its $1,500 level in April, bolstered by consistent positive inflows to ETH Spot ETFs and rising corporate interest in building ETH treasuries. ETH funding rates follow the broader positive trend of the market.

For detailed insights, readers may download the full report.

- Advertisement -

#Bybit / #TheCryptoArk / #BybitLearn

- Advertisement -

About Bybit

- Advertisement -

Bybit is the world’s second-largest cryptocurrency exchange by trading volume, serving a global community of over 70 million users. Founded in 2018, Bybit is redefining openness in the decentralized world by creating a simpler, open and equal ecosystem for everyone. With a strong focus on Web3, Bybit partners strategically with leading blockchain protocols to provide robust infrastructure and drive on-chain innovation. Renowned for its secure custody, diverse marketplaces, intuitive user experience, and advanced blockchain tools, Bybit bridges the gap between TradFi and DeFi, empowering builders, creators, and enthusiasts to unlock the full potential of Web3. Discover the future of decentralized finance at Bybit.com.

- Advertisement -

For more details about Bybit, please visit Bybit Press
For media inquiries, please contact: media@bybit.com
For updates, please follow: Bybit’s Communities and Social Media

- Advertisement -

Discord | Facebook | Instagram | LinkedIn | Reddit | Telegram | TikTok | X | Youtube

- Advertisement -

Photo – https://mma.prnewswire.com/media/2738374/1.jpg

- Advertisement -

Logo – https://mma.prnewswire.com/media/2267288/Logo.jpg

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/bybit–block-scholes-report-markets-surge-past-4-trillion-as-regulatory-wins-drive-record-highs-302513960.html

- Advertisement -
Sonata Software Collaborates with Wharton AI & Analytics Initiative to Advance Understanding of Agentic AI in Enterprise Operations
SEMI Foundation, in Partnership with NSF, Opens National RFP for Regional Nodes to Advance Microelectronics Workforce Development
Oculis to Present Clinical Trial Results in Diabetic Macular Edema and Acute Optic Neuritis at Ophthalmology Conferences
Dubai advances position as Middle East, Africa and South Asia’s leading global financial centre
Adaptive Biotechnologies to Report First Quarter 2026 Financial Results on May 5, 2026
TAGGED:blockbybitdrivehighsmarketsnewspastrecordregulatoryreportscholessurgetrillionwins
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News

Las Vegas News Briefs May 2025

TheNews Market
TheNews Market
04/06/2025
Future Minerals Forum Unveils Three-Day Program for Its 5th Largest Edition
Bybit Recognized as Trusted Partner in Vietnam’s Digital Future at High-Level Dubai Meeting
HealthEquity Introduces GLP-1 Telehealth and Direct HSA Enrollment Platforms
Second International Symposium on Yeast Protein Science and Technology Concludes in Yichang
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?