By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: Artprice by Artmarket congratulates Xie Lei, winner of the 2025 Marcel Duchamp Prize, awarded by ADIAF at the Muse d’Art Moderne de Paris
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > News > Artprice by Artmarket congratulates Xie Lei, winner of the 2025 Marcel Duchamp Prize, awarded by ADIAF at the Muse d’Art Moderne de Paris
Artprice by Artmarket congratulates Xie Lei, winner of the 2025 Marcel Duchamp Prize, awarded by ADIAF at the Muse d’Art Moderne de Paris
News

Artprice by Artmarket congratulates Xie Lei, winner of the 2025 Marcel Duchamp Prize, awarded by ADIAF at the Muse d’Art Moderne de Paris

Last updated: 28/10/2025 6:38 AM
Published: 28/10/2025
Share
SHARE

PARIS, Oct. 27, 2025 /PRNewswire/ — On October 23 in Paris, the 25th edition of the Marcel Duchamp Prize was awarded to Xie Lei, chosen from among four short-listed artists representing the vitality, diversity and international reach of the French scene. Between vulnerability, and metamorphosis, science and poetry, this edition highlighted an art in dialogue with its era.

- Advertisement -

After Frieze London, Art Basel Paris opens its doors at the Grand Palais, while the auction houses unveil their autumn masterpieces.

- Advertisement -

Meanwhile, the art world has been celebrating another major event: the award of the Marcel Duchamp Prize, initiated by the ADIAF (Association for the International Diffusion of French Art) and supported by Artprice by Artmarket.

- Advertisement -

The Marcel Duchamp Prize was initiated 25 years ago by a group of French collectors and the ADIAF. It received significant impetus from French collector Gilles Fuchs, who noted a decline in the international reputation of French artists in the 1990s. His motivation was to contribute to a better representation and promotion of French art in a delicate context for the French contemporary art market.

- Advertisement -

This year, the prestigious Prize was awarded to painter Xie Lei, whose paintings occupy a disconcerting space between dreams and reality, inviting us to slow the pace of our visual consumption and rediscover the emotional power of images.

- Advertisement -

Thierry Ehrmann, Founder of Artprice and CEO of Artmarket.com, praised “the creativity, symbolic power and diversity” of this edition, congratulating the winner Xie Lei as well as finalists Bianca Bondi, Eva Nielsen and Lionel Sabatté, all examples of the wealth of the current French art scene:

- Advertisement -

“Artprice by Artmarket is very proud to support the Association for the International Diffusion of French Art (ADIAF) and the Marcel Duchamp Prize. In a context where Paris is establishing itself as the most dynamic marketplace in the world in terms of the number of contemporary works sold at auction, the Marcel Duchamp Prize fully contributes to the promotion of the French art scene and its influence. This ambition is shared by the Minister of Culture, Madame Rachida Dati, in her new plan to strengthen the French contemporary art scene.”

- Advertisement -

Claude Bonnin, President of ADIAF :

- Advertisement -

“For 25 years, each edition of the Marcel Duchamp Prize has been a tribute to the vitality and creativity of the contemporary French art scene. On behalf of the 300 collectors of the ADIAF, I would like to warmly congratulate the winner, Xie Lei. I am delighted with the quality of the Marcel Duchamp Prize exhibition, presented for the first time this year at the Musée d’Art Moderne de Paris. This edition exemplifies the superb collective formed by the State, the City of Paris, and the ADIAF around a common objective: to promote the French scene by giving essential visibility to its artists, in France and internationally. I would also like to emphasize that, in addition to this exhibition, the four finalists will benefit from our association’s support program, including residencies at the Manufacture de Sèvres and the Villa Albertine as well as exhibitions abroad.”

- Advertisement -

A prize has become a global benchmark

- Advertisement -

In a quarter of a century, the Marcel Duchamp Prize has established itself as a major marker of contemporary creation, comparable to the prestigious British Turner Prize and the American Hugo Boss Prize. Supported by the French Ministry of Culture and a number of major public institutions, each year it highlights French or French-domiciled artists whose works embody the vitality, diversity, and quality of the current scene.

- Advertisement -

The winner receives an endowment of €35,000 and support from a museum with a view to enhancing their international visibility, in conjunction with a network of partners such as the French Institute, the Manufacture de Sèvres, national Museums, and the Villa Albertine in the United States.

- Advertisement -

Beyond the financial reward, the “Prix Marcel Duchamp” is therefore a substantial recognition accelerator that has already benefited artists like Dominique Gonzalez-Foerster, Kader Attia, Tatiana Trouvé, Tarik Kiswanson and Melik Ohanian, whose recognitions all extended well beyond French borders after being nominated as winners of the prize.

- Advertisement -

As Claude Bonnin, President of ADIAF: “The Marcel Duchamp Prize is not intended to reward emerging artists, but to support those with international potential.”

- Advertisement -

This greater visibility naturally translates into the art market, with the winners gaining easier access to museum collections and their galleries benefiting from a stronger sales dynamic. Above all, the Prize confers lasting critical legitimacy, placing their works in the long term, somewhat above the fluctuations of fashion and short-term trends.

- Advertisement -

The 2025 finalists

- Advertisement -

The 2025 edition of the Marcel Duchamp Prize once again attests to the vitality and diversity of the French scene, bringing together four artists with unique paths and worlds, exploring themes of materiality, memory, and metamorphosis.

- Advertisement -

For Bianca Bondi (born in 1986 in Johannesburg, represented by the gallery Mor Charpentier, Paris), transformation is a process as poetic as it is spiritual. Her installation Silent House evokes a dwelling suspended between dream and memory: patinated furniture, plants and salt basins are covered in crystals, revealing the living memory of matter and the beauty of the passage of time.

- Advertisement -

–
Discover Bianca Bondi on Artprice

- Advertisement -

Eva Nielsen (born in 1983 in Les Lilas near Paris, represented by the galleries Peter Kilchmann and The Pill) explores the porosity of images and surfaces. A painter-photographer, she layers latex, leather, silk, and screen printing to create fragmented landscapes where the memory of places dissolves into the pictorial texture. Her works invite a stratified interpretation of reality, between figuration and abstraction.

- Advertisement -

–
Discover Eva Nielsen on Artprice

- Advertisement -

For Lionel Sabatté (born in 1975 in Toulouse, represented by the Ceysson & Bénétière gallery), matter becomes memory. True to his practice of collecting – dust, ash, dead skin, tree fragments – this time, the artist has gleaned the residues of the Museum of Modern Art in Paris, to create a new series of dust drawings. Between fragility and mystery, he makes the invisible a tangible presence.

- Advertisement -

–
Discover Lionel Sabatté on Artprice

- Advertisement -

Finally, Xie Lei (born in 1983 in China, represented in Paris by the Semiose gallery) deploys an introspective style of painting, nourished by literary and cinematographic references. His canvases, bathed in ambiguity, suspend the gaze between dream and reality. Against the current of contemporary celerity, he offers a deceleration of time, a meditation on the persistence of images and the depth of the visible.

- Advertisement -

–
Discover Xie Lei on Artprice

- Advertisement -

From among these diverse approaches – between materiality, memory, and perception – the jury chose to distinguish Xie Lei for the singular strength of his work and the relevance of his reflection on contemporary societal issues.           

- Advertisement -

A changing French scene

- Advertisement -

The 2025 selection of artists highlights how the French scene is becoming increasingly international while asserting its own identity: a focus on technique, materials, memory and the environment. These artists do not claim to be part of a “French style” but rather have adopted a posture of openness, where the boundaries between disciplines and origins are blurred.

- Advertisement -

The ADIAF, true to its original spirit, continues to play a leading role in this dynamic. By organizing more than sixty workshop visits each year across France and abroad, it maintains a dynamic link with creations in progress. This fieldwork feeds into a highly demanding selection process, supported by more than 300 committed art collectors.

- Advertisement -

A 2025 edition marked by a change of venue

- Advertisement -

This 25th edition has a special significance: for the first time, the exhibition of the nominated artists was held not at the Centre Pompidou, which is currently undergoing renovation for four years, but at the Musée d’Art Moderne of Paris (MAM). This change of setting, far from being anecdotal, was an opportunity to rethink the presentation of the Prize and the exhibition of artists’ works. Its curators, Julia Garimorth and Jean-Pierre Criqui, have made every effort to offer a coherent journey through the diversity of the proposals.

- Advertisement -

Fabrice Hergott, Director of the Musée d’Art Moderne of Paris:

- Advertisement -

“Xie Lei’s paintings are a particularly accomplished expression for the beginning of the 21st century. Since the September 11, 2001 attacks, there has been a general feeling of doubt and vertigo. Lei’s work offers a representation that is both concise and captivating, making him one of the most remarkable figures of the new French scene. We are happy to be able to show them at the Museum of Modern Art as part of the 25th prestigious Marcel Duchamp Prize.”

- Advertisement -

For the ADIAF, this edition of the Marcel Duchamp Prize celebrates a quarter of a century of collective commitment to promoting the French scene, not as a school or a style, but as a true laboratory of experimentation. As the Centre Pompidou begins its transformation and the Musée d’Art Moderne of Paris reaffirms its support for the artists of our time, this 2025 edition embodies a transition full of vitality, welcomed by a large and enthusiastic audience.

- Advertisement -

A powerful symbol for French art – and a substantial boost for the future of its winner.

- Advertisement -

You can visit:

- Advertisement -

The exhibition of the four artists nominated for the 2025 Marcel Duchamp Prize, with no appointment and no charge. The exhibition is open on the Collections Floor of the Museum of Modern Art of Paris until 22 February 2026

- Advertisement -

and read:

- Advertisement -

“Paris, capital of a market searching for equilibrium”, Contemporary Art Market Report 2025

When magic meets art; the captivating world of Bianca Bondi

Lionel Sabatté, an alchemist of dust

In the work of visual artist Eva Nielsen, landscapes leave their imprints on the work

Xie Lei’s paintings capture a disturbing strangeness

- Advertisement -

Images:
[https://imgpublic.artprice.com/img/wp/sites/11/2025/10/IMG-1-XIE-LEI-Copyright_Margot-Montigny.jpg] [https://imgpublic.artprice.com/img/wp/sites/11/2025/10/IMG-2-Artprice-2025-Contemporary-Art-Market-Report-cover-xl.png]

- Advertisement -

Copyright 1987-2025 thierry Ehrmann

www.artprice.com

–

www.artmarket.com

- Advertisement -

Artprice’s econometrics department can answer all your questions relating to personalized statistics and analyses: econometrics@artprice.com 

- Advertisement -

Find out more about our services with the artist in a free demonstration: https://artprice.com/demo

- Advertisement -

Our services: https://artprice.com/subscription

- Advertisement -

About Artmarket.com:

- Advertisement -

Artmarket.com is listed on Eurolist by Euronext Paris. The latest TPI analysis includes more than 18,000 individual shareholders excluding foreign shareholders, companies, banks, FCPs, UCITS: Euroclear: 7478 – Bloomberg: PRC – Reuters: ARTF.

- Advertisement -

Watch a video about Artmarket.com and its Artprice department: https://artprice.com/video

- Advertisement -

Artmarket and its Artprice department were founded in 1997 by thierry Ehrmann, the company’s CEO. They are controlled by Groupe Serveur (created in 1987). cf. the certified biography from Who’s Who In France©:

- Advertisement -

https://imgpublic.artprice.com/img/wp/sites/11/2025/02/2025-Biographie_de_Thierry_Ehrmann-Who-s-Who-In-France.pdf

- Advertisement -

Artmarket is a global player in the Art Market with, among other structures, its Artprice department, world leader in the accumulation, management and exploitation of historical and current art market information (the original documentary archives, codex manuscripts, annotated books and auction catalogs acquired over the years) in databanks containing over 30 million indices and auction results, covering more than 879,900 artists.

- Advertisement -

Artprice Images® allows unlimited access to the largest art market image bank in the world with no less than 181 million digital images of photographs or engraved reproductions of artworks from 1700 to the present day, commented by our art historians.

- Advertisement -

Artmarket, with its Artprice department, constantly enriches its databases from 7,200 auction houses and continuously publishes art market trends for the main agencies and press titles in the world in 121 countries and 11 languages.

https://www.prnewswire.com/news-releases/artmarketcom-artprice-and-cision-extend-their-alliance-to-119-countries-to-become-the-worlds-leading-press-agency-dedicated-to-the-art-market-nfts-and-the-metaverse-301431845.html

Artmarket.com makes available to its 9.3 million members (members log in) the advertisements posted by its Members, who now constitute the first global Standardized Marketplace® for buying and selling artworks at fixed prices.

There is now a future for the Art Market with Artprice’s Intuitive Artmarket® AI.

Artmarket, with its Artprice department, has twice been awarded the State label “Innovative Company” by the French Public Investment Bank (BPI), which has supported the company in its project to consolidate its position as a global player in the art market.

Artprice by Artmarket publishes its 2025 Contemporary Art Market Report:


https://www.artprice.com/artprice-reports/the-contemporary-art-market-report-2025

See our 2024 Global Art Market Annual Report, published in March 2025 by Artprice by Artmarket: https://www.artprice.com/artprice-reports/the-art-market-in-2024

Summary of Artmarket press releases with its Artprice department: https://serveur.serveur.com/artmarket/press-release/en/

Follow all the Art Market news in real-time with Artmarket and its Artprice department on Facebook and Twitter:

www.facebook.com/artpricedotcom/ (more than 6.5 million subscribers)
twitter.com/artmarketdotcom
twitter.com/artpricedotcom

Discover the alchemy and the universe of Artmarket and its Artprice department: https://www.artprice.com/video

whose head office is the famous Museum of Contemporary Art Abode of Chaos dixit The New York Times / La Demeure of Chaos:

https://issuu.com/demeureduchaos/docs/demeureduchaos-abodeofchaos-opus-ix-1999-2013

Madame Rachida Dati, French Minister of Culture, has granted official recognition to thierry Ehrmann’s Abode of Chaos as a ‘total work of art’, the global headquarters of Artprice by Artmarket.
https://www.prnewswire.com/news-releases/madame-rachida-dati-french-minister-of-culture-has-granted-official-recognition-to-thierry-ehrmanns-abode-of-chaos-as-a-total-work-of-art-the-global-headquarters-of-artprice-by-artmarket-302409684.html

La Demeure du Chaos/Abode of Chaos – Total Work of Art and Singular Architecture.

Confidential bilingual work, now made public: https://ftp1.serveur.com/abodeofchaos_singular_architecture.pdf

  • L’Obs – The Museum of the Future: https://youtu.be/29LXBPJrs-o
  • https://www.facebook.com/la.demeure.du.chaos.theabodeofchaos999 (more than 4.1 million subscribers)
  • https://vimeo.com/124643720

Contact Artmarket.com and its Artprice department –  Thierry Ehrmann, Contact: ir@artmarket.com

Photo – https://mma.prnewswire.com/media/2805977/IMG_1_XIE_LEI_Copyright_Margot_Montigny.jpg
Photo – https://mma.prnewswire.com/media/2805976/IMG_2_Artprice_2025_Contemporary_Art_Market_Report_Cover_xl.jpg
Logo – https://mma.prnewswire.com/media/2260897/5584280/Artmarket_logo.jpg

View original content:https://www.prnewswire.co.uk/news-releases/artprice-by-artmarket-congratulates-xie-lei-winner-of-the-2025-marcel-duchamp-prize-awarded-by-adiaf-at-the-musee-dart-moderne-de-paris-302595439.html

Newest Innovation in Protein: Proathlix’s 9-Source Protein Blend with Veg Collagen Peptide
SED Wins VA Tech Wabag Contract for Solar Manufacturing Wastewater Recovery Project
UnionPay International and Bank of China Frankfurt Branch Launch SplendorPlus Debit Card in Germany, Marking its European Debut
Bybit Launches P2P Super Deal With 99% Off and Apple Watch Prizes for New Users
Nexteer Automotive Breaks Ground on APAC Smart Manufacturing Project in Suzhou
TAGGED:2025adiafartmarketartpriceawardedcongratulatesd’artduchampleimarcelmodernemusenewsparisprizethewinnerxie
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
9fin launches in APAC to expand global credit coverage
News

9fin launches in APAC to expand global credit coverage

23/04/2026
Global Millennial Capital Raises USD 100 Million to Fund New-Age Technology Leaders in Underpenetrated Mid-Cap Segments
JUNGHWAN LEE TRIUMPHS AT 2025 GENESIS CHAMPIONSHIP
ASSEMBLY APPOINTS ALAP GHOSH AS FIRST CEO OF INDIA
Vanqua Bio to Present at Upcoming Scientific Conferences
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?