By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: Bybit USD1 Ecosystem Carnival: Three New Trading Pairs, Three Winning Tracks
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > News > Bybit USD1 Ecosystem Carnival: Three New Trading Pairs, Three Winning Tracks
Bybit USD1 Ecosystem Carnival: Three New Trading Pairs, Three Winning Tracks
News

Bybit USD1 Ecosystem Carnival: Three New Trading Pairs, Three Winning Tracks

Last updated: 23/04/2026 5:37 PM
Published: 23/04/2026
Share
SHARE

DUBAI, UAE, April 22, 2026 /PRNewswire/ — Bybit, the world’s second-largest cryptocurrency exchange by trading volume, is excited to launch the USD1 Trading Campaign Series, introducing new USD1 trading pairs, zero-fee trading pairs, and 10,000,000 WLFI in rewards across three prize pools.  

- Advertisement -

With three new USD1-quoted trading pairs and counting, Bybit continues to enhance trading experience for its diverse user base. From April 22 to May 22, 2026, successful participants of Bybit’s exclusive USD1-themed events can divide up three generous prize pools, with opportunities to win up to 15,000 WFLI per user.

- Advertisement -

New USD1 Trading Pairs

- Advertisement -

New USD1 trading pairs are coming to Bybit Spot. USD1 has been supported on Bybit across USD1/USDT and MNT/USD1 pairs. The additions mark a significant expansion of Bybit’s stablecoin infrastructure, introducing three new USD1-quoted trading pairs:

- Advertisement -
  • BTC/USD1 
  • ETH/USD1
  • USDC/USD1

To mark the launch of new trading pairs, Bybit Spot is waiving platform fees for USD1/USDT and USDC/USD1 pairs for a limited time only.

- Advertisement -

More USD1-quoted trading pairs are on the road map for Bybit traders, reflecting broader market demand for diversified stablecoin rails and alternative settlement mechanisms.

- Advertisement -

Trading with USD1 on Bybit: Three Ways to Earn Rewards 

- Advertisement -

As Bybit continues to expand its USD1 ecosystem, Bybit users stand to make their trading experience more rewarding by taking advantage of three limited-time events:

- Advertisement -
  1. USD1 Spot Token Splash: From April 22 to May 6, 2026, traders can unlock a 6,000,000 WLFI prize pool by trading eligible USD1 spot pairs. Rewards are based on trading volume, starting with a minimum of 500 USDT, for a chance to win up to 15,000 WLFI in rewards per user. MNT/USD1, BTC/USD1 and ETH/USD1 pairs are eligible for this prize pool.
  2. USD1 Alpha Token Splash: From April 22 to May 6, 2026, 1,000,000 WLFI in rewards are up for grabs for USD1 traders on Bybit Alpha. Participation starts at 500 USDT in minimum trading volume with rewards capped at 12,000 WLFI per participant. USD1 supported on the Mantle chain is eligible for this prize pool.
  3. USD1 Puzzle Hunt: From May 6 to 22, 2026, the Bybit exclusive USD1 Puzzle Hunt introduces a gamified layer with 3,000,000 WLFI available. Upon signing up, users can accumulate puzzle pieces through a variety of activities, including daily check-ins and trading, deposit and trading tasks, successful referrals, extra missions, teaming up with friends, or simply exploring Bybit’s AI-powered research tool TradeGPT and social media engagements. The adventure culminates in a lucky draw offering up to 3 guaranteed-win opportunities for participants with 3 consecutive puzzle pieces, and a grand prize of 2,000 WLFI for the first 500 participants to complete the entire puzzle. MNT/USD1, BTC/USD1 and ETH/USD1 pairs are eligible for this prize pool.

Registration is required and terms and conditions apply. For details on eligibility and potential restrictions, users may visit: USD1 Ecosystem Carnival Begins – Share 10,000,000 WLFI Rewards

- Advertisement -

As the broader stablecoin ecosystems evolve, traders and market markets are increasingly looking for more entry points into new markets. Bybit is committed to diversifying its offerings and expanding access to emerging opportunities for its global trading community.

- Advertisement -

#Bybit / #CryptoArk / #IMakeIt 

- Advertisement -

About Bybit

- Advertisement -

Bybit is the world’s second-largest cryptocurrency exchange by trading volume, serving a global community of over 80 million users. Founded in 2018, Bybit is redefining openness in the decentralized world by creating a simpler, open and equal ecosystem for everyone. With a strong focus on Web3, Bybit partners strategically with leading blockchain protocols to provide robust infrastructure and drive on-chain innovation. Renowned for its secure custody, diverse marketplaces, intuitive user experience, and advanced blockchain tools, Bybit bridges the gap between TradFi and DeFi, empowering builders, creators, and enthusiasts to unlock the full potential of Web3. Discover the future of decentralized finance at Bybit.com.

- Advertisement -

For more details about Bybit, please visit Bybit Press
For media inquiries, please contact: media@bybit.com
For updates, please follow: Bybit’s Communities and Social Media

- Advertisement -

Discord | Facebook | Instagram | LinkedIn | Reddit | Telegram | TikTok | X | Youtube

- Advertisement -

Photo – https://mma.prnewswire.com/media/2963178/Bybit_USD1_Ecosystem_Carnival_Three_New_Trading_Pairs_Three_Winning.jpg

- Advertisement -

Logo – https://mma.prnewswire.com/media/2932256/Bybit_TNFP_Logo.jpg

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/bybit-usd1-ecosystem-carnival-three-new-trading-pairs-three-winning-tracks-302750325.html

- Advertisement -
Canara HSBC Life Insurance Launches Promise4Life: A Participating Plan with Guaranteed Income and Life Cover Up to Age 100
Kotak Life Recognised Among India’s Top Life Insurers for Customer Experience
Alamar Biosciences Announces Close of Oversubscribed Convertible Notes Financing and Expansion of Leadership Team
Celldex Presents Positive Data from Phase 2 Chronic Spontaneous Urticaria and Phase 2 Cold Urticaria and Symptomatic Dermographism Studies Demonstrating Rapid, Profound and Durable Improvements in Patient Quality of Life at AAD 2026
LEPAS L8 Elevates Every Family Journey with Elegant Driving and Exquisite Space
TAGGED:bybitcarnivalecosystemnewnewspairsthreetrackstradingusd1winning
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
STARTRADER Breaks Ground on Basketball Court Revamp Benefiting around 20,000 Students in Davao City, Philippines
Entertainment

STARTRADER Breaks Ground on Basketball Court Revamp Benefiting around 20,000 Students in Davao City, Philippines

PRNW Agency
PRNW Agency
10/07/2026
Unseenlabs Announces its Second Generation of Satellite for RF Detection Dedicated to Multi-domain Awareness
MatchMove Receives Frost & Sullivan’s 2025 Singapore Enabling Technology Leadership Recognition for Excellence in Embedded Finance Innovation
Trigent and Codec Partner to Launch Global Capability Centres in Bengaluru and Hyderabad
NSA Labs Helps Leading Biopharmaceutical Companies Get Study Results Faster on Proscias Platform
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?