By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: BCMGlobal appointed to support the advancement of the National Financing Support Services Company (NFSC) as a best-in-class independent loan servicer in the Kingdom of Saudi Arabia
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > News > BCMGlobal appointed to support the advancement of the National Financing Support Services Company (NFSC) as a best-in-class independent loan servicer in the Kingdom of Saudi Arabia
BCMGlobal appointed to support the advancement of the National Financing Support Services Company (NFSC) as a best-in-class independent loan servicer in the Kingdom of Saudi Arabia
News

BCMGlobal appointed to support the advancement of the National Financing Support Services Company (NFSC) as a best-in-class independent loan servicer in the Kingdom of Saudi Arabia

Last updated: 21/11/2025 1:36 AM
Published: 21/11/2025
Share
SHARE

LONDON, Nov. 20, 2025 /PRNewswire/ — BCMGlobal, one of Europe’s leading independent loan and mortgage servicing firms and an affiliate of LCM Partners, has been appointed to manage the National Financing Support Services Company (NFSC) and to support its advancement into a best-in-class independent loan servicer in the Kingdom of Saudi Arabia.

- Advertisement -

Established by the Saudi Real Estate Development Fund (REDF) and the Saudi Real Estate Refinance Company (SRC), NFSC plays a central role in strengthening the Kingdom’s mortgage and consumer finance sectors. Its mandate supports Saudi Arabia’s Vision 2030 objectives to diversify and deepen the national financial system.

- Advertisement -

Building on more than 25 years of experience across Europe, BCMGlobal will deploy a senior team to the Kingdom, including the forthcoming appointment of a Head of Servicing to lead the next phase of NFSC’s development. The company will expand its service lines and local footprint, with plans to recruit and build operational capacity in Saudi Arabia. BCMGlobal’s remit includes broadening NFSC’s servicing capabilities beyond residential mortgages to encompass consumer and commercial loans, while introducing back-up servicing and facility agency services to support the region’s evolving financial ecosystem.

- Advertisement -

These developments will provide critical infrastructure for both domestic institutions and international lenders seeking to participate in the Kingdom’s rapidly growing financial markets. BCMGlobal has already seen strong early interest from leading global banks and investment houses, reflecting the quality of international engagement being drawn to the Kingdom’s financial sector.

- Advertisement -

“With over 25 years of experience managing performing, re-performing and non-performing loans, BCMGlobal brings deep operational and data expertise to the Kingdom,” said Simon Fitness, Chief Executive Officer of BCMGlobal. “We are committed to embedding ourselves within the local market – both operationally and as an employer – building teams and technology in the Kingdom that deliver world-class servicing aligned with the goals of Vision 2030.”

- Advertisement -

Paul Burdell, Chief Executive Officer of LCM Partners, added: “Saudi Arabia continues to demonstrate world-class ambition and leadership in developing its financial markets. We are proud to play a supporting role alongside partners such as REDF and SRC, whose vision and commitment to excellence are helping shape a modern and dynamic financial services sector. BCMGlobal’s servicing expertise, data capabilities and technology will complement these efforts and contribute to building an institution of enduring strength and capability in the NFSC.”

- Advertisement -

With approximately €45 billion of assets under management and operations across five European jurisdictions, BCMGlobal provides end-to-end loan servicing, portfolio management and data analytics solutions for more than 125 financial institutions. Its appointment to work with NFSC marks a significant milestone in BCMGlobal’s international expansion and underlines its role as a strategic partner in the evolution of financial services infrastructure in the Kingdom of Saudi Arabia.

- Advertisement -

About BCMGlobal

- Advertisement -

BCMGlobal is one of Europe’s leading independent loan and mortgage servicing firms, specialising in end-to-end asset management, loan administration and data-driven servicing technology. Operating across the UK, Ireland, the Netherlands, Italy and Spain, BCMGlobal manages more than €45 billion in assets and provides solutions to over 125 banking and financial institutions. BCMGlobal is part of the LC Financial Holdings group and an affiliate of LCM Partners.

- Advertisement -

Media Contact:
Alison Swonnell
Managing Director, Client Solutions
E: ASwonnell@LCMPartners.eu 
W: www.bcmglobal.com 

- Advertisement -

 

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/bcmglobal-appointed-to-support-the-advancement-of-the-national-financing-support-services-company-nfsc-as-a-best-in-class-independent-loan-servicer-in-the-kingdom-of-saudi-arabia-302622202.html

- Advertisement -
COLGATE DEBUTS FIRST-EVER VISIBLE WHITE PURPLE SERUM: A GAME-CHANGER IN ORAL BEAUTY
Bound’s Publishing Course is building the next generation of creative professionals
National Film Board of Canada brings Lavis and Szczerbowski’s Oscar-winning The Girl Who Cried Pearls to audiences around the world
Tower Semiconductor Receives Best Supplier Award from Wisol for Excellence in RF SOI Technology and Supply Chain Support
Vivoryon Therapeutics N.V. to Report H1 2025 Financial Results and Operational Progress on September 4, 2025
TAGGED:(nfsc)advancementappointedarabia,bcmglobalbest-in-classcompanyfinancingindependentkingdomloannationalnewssaudiservicerservicessupportthe
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
Rokid Launches the World’s First Open AI Ecosystem Smart Glasses — Ultra-Light, Prescription-First, and Built to Work with ChatGPT, Qwen, DeepSeek, and More
News

Rokid Launches the World’s First Open AI Ecosystem Smart Glasses — Ultra-Light, Prescription-First, and Built to Work with ChatGPT, Qwen, DeepSeek, and More

07/01/2026
Sentient Digital, Inc. (SDi) Partners with Viasat to Support Korea Coast Guard Maritime Domain Awareness and Information Sharing Missions
No Drag. Just Drive. Vectorworks 2026 Coming Soon
Promises Take Center Stage in Canara HSBC Life Insurance’s New Campaign Featuring Jasprit Bumrah and Sanjana Ganesan
Elliott Statement on Sumitomo Realty & Development Co., Ltd.
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?