By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: NYSE Content Advisory: Pre-Market Update + Automakers await 5-year tariff relief extension
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > News > NYSE Content Advisory: Pre-Market Update + Automakers await 5-year tariff relief extension
News

NYSE Content Advisory: Pre-Market Update + Automakers await 5-year tariff relief extension

Last updated: 18/10/2025 12:37 AM
Published: 18/10/2025
Share
SHARE

NEW YORK, Oct. 17, 2025 /PRNewswire/ — The New York Stock Exchange (NYSE) provides a daily pre-market update directly from the NYSE Trading Floor. Access today’s NYSE Pre-market update for market insights before trading begins. 

- Advertisement -

Kristen Scholer delivers the pre-market update on October 17th

- Advertisement -
  • Stocks are lower early Friday after regional bank reports created concerns over bad loans. Loose lending practices pushed traders into safe havens. Activity in the banking sector could inform the Fed’s next decision on interest rates.  
  • Tariff relief is expected for the auto industry after a lobbying push according to reports. The Commerce Department will announce a five-year extension for an agreement that allows carmakers to reduce what they pay in tariffs on car imports.
  • Koom 2025 kicked off yesterday in Brooklyn. The three-day conference celebrates Korean start-up culture, innovation, and K-Pop. Korean business leaders will be in attendance.


Opening Bell

The Breast Cancer Research Foundation highlights its mission to end breast cancer by advancing the world’s most promising research

- Advertisement -


Closing Bell


National Fallen Firefighters Foundation honors and remembers 176 Fallen Firefighters

- Advertisement -


Click here to download the NYSE TV App

- Advertisement -

 

- Advertisement -

Video – https://mma.prnewswire.com/media/2799213/NYSE_Market_Update_Oct_17.mp4

- Advertisement -

Logo – https://mma.prnewswire.com/media/2581322/New_York_Stock_Exchange_Logo.jpg

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/nyse-content-advisory-pre-market-update–automakers-await-5-year-tariff-relief-extension-302587590.html

- Advertisement -
When Courage Meets the Constitution: The 3rd Fight 4 Justice Awards Honour India’s uiet Defenders of Justice
Diageo India and WSET Launch Landmark Initiative powered by Diageo Bar Academy to Empower Women in the Bar Industry
Aptose Biosciences Announces Rescheduling of Special Meeting of Shareholders to Approve the Acquisition by Hanmi Pending Final Clearance from SEC
Precise docking + ecological co-construction: Yingfa Ruineng is lightly loaded at SNEC Exhibition
ReCerf Receives its CE Mark, Advancing Access to Ceramic Hip Resurfacing Across Europe
TAGGED:5-yearadvisoryautomakersawaitcontentextensionnewsnysepre-marketrelieftariffupdate
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
Cango Receives Buy Rating, Upbeat on its Asset-light Mining Model and AI Potential
News

Cango Receives Buy Rating, Upbeat on its Asset-light Mining Model and AI Potential

24/12/2025
नोबेल पुरस्कार 2025 – मेडिसिन कैटेगरी में तीन वैज्ञानिकों की शानदार जीत!
Lupin Strengthens its Global Specialty Ophthalmology Business with Acquisition of VISUfarma from GHO Capital
Newest Innovation in Protein: Proathlix’s 9-Source Protein Blend with Veg Collagen Peptide
Xinhua Silk Road: NE. China-located ice city hails opening of frozen wonderland on Wednesday
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?