By using this site, you agree to the Privacy Policy and Terms of Use.
Accept
AdkhabarAdkhabarAdkhabar
Notification Show More
Font ResizerAa
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Reading: LifeSpan Portfolio Company Remedium Signs Landmark Deal with Eli Lilly
Share
Font ResizerAa
AdkhabarAdkhabar
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Search
  • Home
  • Automobile
  • Entertainment
  • Esports
  • Food
  • Health
  • Life Style
  • News
  • Technology
  • Travel
Follow US
Adkhabar > Blog > News > LifeSpan Portfolio Company Remedium Signs Landmark Deal with Eli Lilly
LifeSpan Portfolio Company Remedium Signs Landmark Deal with Eli Lilly
News

LifeSpan Portfolio Company Remedium Signs Landmark Deal with Eli Lilly

Last updated: 23/09/2025 10:37 PM
Published: 23/09/2025
Share
SHARE

NORWALK, Conn., Sept. 23, 2025 /PRNewswire/ — Lifespan Vision Ventures is pleased to announce that its portfolio company, Remedium Bio, Inc. (“Remedium”), has entered into a multi-target research and development collaboration with Eli Lilly and Company (“Lilly”) focused on advancing innovative gene therapies for Type 2 diabetes and obesity.

- Advertisement -

This partnership underscores the promise of Remedium’s proprietary Prometheus™ platform and the company’s leadership in developing long-acting, adjustable-dose therapeutics for major unmet medical needs. This approach aims to replace repeated protein-based injections with a safer, more consistent, and more cost-effective treatment, enabling genetic medicine to address common conditions across endocrinology, immunology, and cardiometabolic disease safely, effectively, and at scale.

- Advertisement -

“We congratulate Frank and the Remedium team on this important milestone with Lilly,” said Andrew Worden, Founding Partner at Lifespan Vision Ventures. “It is a powerful validation of their platform and is an important step toward developing interventions that extend healthspan. We’re excited to support Remedium as they scale their platform and translate it into therapies that can benefit millions of patients.”

- Advertisement -

About Remedium Bio

- Advertisement -

Remedium Bio is advancing a new generation of gene therapies to address major unmet medical needs across endocrinology, immunology, neurology, and musculoskeletal diseases. Its proprietary Prometheus™ platform enables long-lasting, adjustable-dose delivery of therapeutic genes through a single subcutaneous injection. This approach has the potential to replace many protein-based treatments at significantly lower cost, while offering patients safe, durable, and tunable control over therapeutic protein expression. Remedium’s pipeline includes multiple programs with the potential to meaningfully reshape the treatment landscape for conditions such as obesity and Type 2 diabetes.

- Advertisement -

For more information, visit: www.remedium-bio.com

- Advertisement -

About LifeSpan Vision Ventures

- Advertisement -

Lifespan Vision Ventures is a forward-thinking venture capital firm specializing in investments within the aging and longevity space. Our mission is to support and accelerate the development of innovative therapies that extend healthspan, improve quality of life as individuals age, and address age-related challenges. Through strategic partnerships and investments, we aim to shape a future where advances in science and technology prevent, delay, and treat age-related diseases; ultimately enabling healthier, longer lives.

- Advertisement -

Contact: info@lifespanvision.com

- Advertisement -

Logo – https://mma.prnewswire.com/media/1780796/LifeSpan_Vision_Ventures_Logo.jpg 

- Advertisement -

View original content:https://www.prnewswire.co.uk/news-releases/lifespan-portfolio-company-remedium-signs-landmark-deal-with-eli-lilly-302564703.html

- Advertisement -
Arkieva demand and production planning solution for Wells Enterprises recognized as Top Supply Chain Project
New micromobility concepts for increased sustainability in urban traffic: BMW Group grants licenses to the LUYUAN Group
Krisp AI Note Taker Raises the Bar for Meetings by Expanding Its AI Meeting Suite With Accent Conversion
GMAC Announces New Board and Member School Additions, Amplifying Focus on Expanding Talent Pipeline
Lingnan University in Hong Kong debuts in THE World University Rankings: Comes 47th globally in International Outlook
TAGGED:companydealelilandmarklifespanlillynewsportfolioremediumsignswith
Share This Article
Facebook Email Print
- Advertisement -

Follow US

Find US on Social Medias
FacebookLike
XFollow
YoutubeSubscribe

Weekly Newsletter

Subscribe to our newsletter to get our newest articles instantly!
Popular News
Italian Leading Fashion Group OVS Opens its Store in New Delhi
News

Italian Leading Fashion Group OVS Opens its Store in New Delhi

16/10/2025
Starlight Investments Expands Asia-Pacific Presence with Senior Hire in Korea
FIS Athletes Commission strengthens global voice at FIS Congress and International Athletes Forum
Jetcraft launches Special Missions division for defense and government aircraft
Inteleos 2026 Leadership Elections Accelerate Vision for Global Healthcare
- Advertisement -
- Advertisement -
- Advertisement -

Categories

  • Automobile
  • Entertainment
  • E-Sports
  • Food
  • Health
  • Technology
  • LifeStyle
  • Travel

About Us

Through our news networks, we raise millions of users' awareness. We are among the world's most reputable news networks.
Quick Link
Top Categories
  • Entertainment

Subscribe US

Subscribe to our newsletter to get our newest articles instantly!

AdkhabarAdkhabar
Copyright © 2021 - 2025 AdKhabar. All Rights Reserved. POWERED BY Life Care News.
Join Us!
Subscribe to our newsletter and never miss our latest news, podcasts etc..
Zero spam, Unsubscribe at any time.
Welcome Back!

Sign in to your account

Username or Email Address
Password

Lost your password?